From 9c509dde9d769a7912bb5a2ee4b91d4f73f1c721 Mon Sep 17 00:00:00 2001 From: speakeasybot Date: Mon, 9 Mar 2026 00:32:46 +0000 Subject: [PATCH 1/2] ## Python SDK Changes: * `clerk.users.get_billing_credit_balance()`: **Added** * `clerk.users.adjust_billing_credit_balance()`: **Added** * `clerk.instance_settings.get_o_auth_application_settings()`: **Added** * `clerk.instance_settings.update_o_auth_application_settings()`: **Added** * `clerk.organizations.get_billing_credit_balance()`: **Added** * `clerk.organizations.adjust_billing_credit_balance()`: **Added** * `clerk.agent_tasks.create()`: **Added** * `clerk.agent_tasks.revoke()`: **Added** * `clerk.email_addresses.create()`: `error.status[409]` **Added** * `clerk.email_addresses.update()`: `error.status[409]` **Added** * `clerk.users.update()`: `error.status[409]` **Added** * `clerk.users.get_billing_subscription()`: `response.subscription_items[]` **Changed** * `clerk.users.get_organization_invitations()`: `request.status` **Changed** * `clerk.organization_invitations.get_all()`: `request.status` **Changed** * `clerk.organization_invitations.create()`: `error.status[402]` **Added** * `clerk.organization_invitations.list()`: `request.status` **Changed** * `clerk.organizations.update()`: `error.status[400]` **Added** * `clerk.organizations.get_billing_subscription()`: `response.subscription_items[]` **Changed** * `clerk.billing.list_plans()`: `response.data[].unit_prices` **Added** * `clerk.billing.list_prices()`: `response.data[].is_default` **Added** * `clerk.billing.create_price()`: `response.is_default` **Added** * `clerk.billing.list_subscription_items()`: `response.data[]` **Changed** * `clerk.billing.cancel_subscription_item()`: `response` **Changed** * `clerk.billing.create_price_transition()`: `response.transition.previous_price.is_default` **Added** * `clerk.billing.list_statements()`: `response.data[]` **Changed** * `clerk.billing.get_statement()`: `response` **Changed** * `clerk.billing.get_statement_payment_attempts()`: `response.data[].totals` **Added** * `clerk.m2m.create_token()`: `request.token_format` **Added** --- .speakeasy/gen.lock | 1977 ++++++++++------- .speakeasy/gen.yaml | 3 +- .speakeasy/workflow.lock | 15 +- README.md | 65 +- RELEASES.md | 12 +- docs/models/action.md | 19 + docs/models/actortokenobject.md | 8 + docs/models/actortokenstatus.md | 8 + docs/models/adjustcreditbalancerequest.md | 12 + ...organizationbillingcreditbalancerequest.md | 9 + .../adjustuserbillingcreditbalancerequest.md | 9 + docs/models/agenttask.md | 13 + docs/models/agenttaskobject.md | 16 + docs/models/allowlistidentifierobject.md | 8 + docs/models/balance.md | 13 + docs/models/billingpaymentattempt.md | 49 +- docs/models/billingpaymentattemptcredits.md | 10 + docs/models/billingpaymentattemptobject.md | 8 + docs/models/billingpaymentattemptpayer.md | 9 + docs/models/billingpaymentattemptproration.md | 11 + docs/models/billingpaymentattemptstatus.md | 8 + docs/models/billingpaymentattempttotals.md | 15 + docs/models/billingpriceresponse.md | 1 + docs/models/billingpriceresponseobject.md | 8 + docs/models/billingstatement.md | 2 +- docs/models/billingstatementgroupsobject.md | 8 + docs/models/billingstatementobject.md | 8 + docs/models/billingstatementstatus.md | 8 + docs/models/billingstatementtotals.md | 13 + .../blocklistidentifieridentifiertype.md | 8 + docs/models/blocklistidentifierobject.md | 8 + docs/models/codetype.md | 8 + docs/models/commercecreditbalanceresponse.md | 11 + docs/models/commercecreditledgerresponse.md | 18 + docs/models/commercepayerresponseobject.md | 8 + .../commercepaymentmethodresponseobject.md | 8 + .../commercepaymentmethodresponsestatus.md | 8 + docs/models/commerceperunittotal.md | 10 + docs/models/commerceperunittotaltier.md | 10 + docs/models/commerceplan.md | 3 +- docs/models/commerceplanobject.md | 8 + docs/models/commerceplanunitprice.md | 10 + docs/models/commerceplanunitpricetier.md | 10 + .../commercepricetransitionresponseobject.md | 8 + docs/models/commercesubscriptionitem.md | 5 +- .../models/commercesubscriptionitemcredits.md | 10 + docs/models/commercesubscriptionitemobject.md | 8 + docs/models/commercesubscriptionitempayer.md | 9 + .../commercesubscriptionitemplanobject.md | 8 + .../commercesubscriptionitemproration.md | 11 + docs/models/commercesubscriptionitemstatus.md | 8 + .../commercesubscriptionitemtotalspayer.md | 9 + docs/models/commercesubscriptionobject.md | 8 + docs/models/commercesubscriptionstatus.md | 8 + docs/models/cookiesobject.md | 8 + docs/models/createagenttaskpermissions.md | 18 + docs/models/createagenttaskrequestbody.md | 13 + docs/models/createapikeyobject.md | 8 + .../createbulkinvitationstemplateslug.md | 8 + docs/models/createm2mtokenobject.md | 8 + docs/models/createm2mtokenrequestbody.md | 9 +- docs/models/createrolesettype.md | 8 + .../createsessiontokenfromtemplateobject.md | 8 + docs/models/createsessiontokenobject.md | 8 + docs/models/credits.md | 12 + docs/models/deleteapikeyobject.md | 8 + docs/models/domainobject.md | 8 + docs/models/domainsenrollmentmodes.md | 8 + docs/models/effectivemode.md | 8 + docs/models/emailaddressobject.md | 10 + docs/models/enrollmentmode.md | 8 + docs/models/enterpriseaccountobject.md | 8 + .../externalaccountwithverificationobject.md | 8 + docs/models/featureresponseobject.md | 8 + docs/models/format_.md | 8 + docs/models/getapikeyobject.md | 8 + docs/models/getapikeysobject.md | 8 + ...rcesubscriptionitemlistqueryparamstatus.md | 8 + docs/models/getm2mtokensobject.md | 8 + ...organizationbillingcreditbalancerequest.md | 8 + .../getuserbillingcreditbalancerequest.md | 8 + docs/models/identifiertype.md | 8 + docs/models/includeinvalid.md | 8 + docs/models/instanceobject.md | 8 + docs/models/instanceprotectobject.md | 8 + docs/models/instancerestrictionsobject.md | 8 + docs/models/instancesettingsobject.md | 8 + docs/models/invitationobject.md | 8 + docs/models/invitationrevokedobject.md | 8 + docs/models/invitationrevokedstatus.md | 8 + docs/models/invitationstatus.md | 8 + docs/models/jwttemplateobject.md | 8 + ...organizationinvitationsqueryparamstatus.md | 11 +- .../models/listinvitationsqueryparamstatus.md | 8 + ...organizationinvitationsqueryparamstatus.md | 11 +- .../listwaitlistentriesqueryparamstatus.md | 8 + docs/models/machinecreatedobject.md | 8 + docs/models/machinedeletedobject.md | 8 + docs/models/machineobject.md | 8 + docs/models/machinescopedeletedobject.md | 8 + docs/models/machinescopeobject.md | 8 + docs/models/machinesecretkeyobject.md | 8 + .../machinewithoutscopedmachinesobject.md | 8 + docs/models/nextaction.md | 8 + docs/models/nonce.md | 8 + docs/models/oauthaccesstokenobject.md | 8 + docs/models/oauthapplicationobject.md | 8 + docs/models/oauthapplicationsettings.md | 12 + docs/models/oauthapplicationsettingsobject.md | 18 + .../oauthapplicationwithsecretobject.md | 8 + docs/models/object.md | 8 + docs/models/onbehalfof.md | 12 + docs/models/organizationdomainobject.md | 8 + docs/models/organizationdomainstatus.md | 8 + docs/models/organizationinvitationobject.md | 8 + ...itationwithpublicorganizationdataobject.md | 8 + docs/models/organizationmembershipobject.md | 8 + ...rganizationmembershiporganizationobject.md | 8 + docs/models/organizationobject.md | 8 + docs/models/organizationsettingsobject.md | 8 + docs/models/organizationwithlogoobject.md | 8 + docs/models/passkeyobject.md | 8 + docs/models/pathparamtemplatetype.md | 8 + docs/models/payertype.md | 8 + docs/models/paymentmethod.md | 8 + docs/models/paymenttype.md | 8 + docs/models/permissionobject.md | 8 + docs/models/phonenumberobject.md | 8 + docs/models/plan.md | 3 +- docs/models/planperiod.md | 8 + docs/models/previoussubscriptionitemstatus.md | 8 + docs/models/proration.md | 11 + docs/models/protocol.md | 8 + docs/models/provider.md | 8 + docs/models/proxycheckobject.md | 8 + docs/models/queryparamenrollmentmode.md | 8 + docs/models/queryparampayertype.md | 8 + docs/models/queryparamstatus.md | 8 + docs/models/redirecturlobject.md | 8 + docs/models/requestbodyprovider.md | 8 + docs/models/responsebodyobject.md | 8 + .../reverttemplatepathparamtemplatetype.md | 8 + docs/models/revokeagenttaskrequest.md | 8 + docs/models/revokeapikeyobject.md | 8 + docs/models/revokem2mtokenobject.md | 8 + docs/models/roleobject.md | 8 + docs/models/rolesetcreatorroleobject.md | 8 + docs/models/rolesetdefaultroleobject.md | 8 + docs/models/rolesetitemobject.md | 8 + docs/models/rolesetobject.md | 8 + docs/models/rolesetrolesetmigrationobject.md | 8 + docs/models/samlaccountobject.md | 8 + docs/models/schemascommerceplanobject.md | 8 + .../schemascommercesubscriptionitemobject.md | 8 + ...emascommercesubscriptionitempayerobject.md | 8 + ...ercesubscriptionitempaymentsourceobject.md | 8 + ...ercesubscriptionitempaymentsourcestatus.md | 8 + ...hemascommercesubscriptionitemplanobject.md | 8 + ...hemascommercesubscriptionitemplanperiod.md | 8 + .../schemascommercesubscriptionitemstatus.md | 8 + docs/models/schemasfeatureresponseobject.md | 8 + docs/models/schemassamlconnection2object.md | 8 + docs/models/schemassamlconnectionobject.md | 8 + docs/models/seats.md | 10 + docs/models/sessionobject.md | 8 + docs/models/signintokenobject.md | 8 + docs/models/signintokenstatus.md | 8 + docs/models/signupobject.md | 8 + docs/models/signupstatus.md | 8 + docs/models/status.md | 8 + docs/models/strategy.md | 10 + docs/models/templateobject.md | 8 + docs/models/templateslug.md | 8 + docs/models/templatetype.md | 8 + docs/models/testingtokenobject.md | 8 + ...letemplatedeliverypathparamtemplatetype.md | 8 + docs/models/tokenformat.md | 17 + docs/models/tokenobject.md | 8 + docs/models/totalcountobject.md | 8 + docs/models/totals.md | 15 +- docs/models/type.md | 8 + docs/models/updateapikeyobject.md | 8 + ...anceoauthapplicationsettingsrequestbody.md | 9 + docs/models/updaterolesettype.md | 8 + .../upserttemplatepathparamtemplatetype.md | 8 + docs/models/userobject.md | 8 + ...organizationinvitationsqueryparamstatus.md | 11 +- .../verificationadminverificationobject.md | 8 + ...ationadminverificationphonenumberobject.md | 8 + ...ationadminverificationphonenumberstatus.md | 8 + .../verificationadminverificationstatus.md | 8 + .../verificationadminverificationstrategy.md | 10 + ...cationadminverificationweb3walletobject.md | 8 + ...cationadminverificationweb3walletstatus.md | 8 + ...tionadminverificationweb3walletstrategy.md | 10 + ...verificationemaillinkverificationobject.md | 8 + ...verificationemaillinkverificationstatus.md | 8 + ...rificationemaillinkverificationstrategy.md | 8 + ...verificationfromoauthverificationobject.md | 8 + ...verificationfromoauthverificationstatus.md | 8 + ...ificationgoogleonetapverificationobject.md | 8 + ...ificationgoogleonetapverificationstatus.md | 8 + ...icationgoogleonetapverificationstrategy.md | 8 + ...authverificationenterpriseaccountobject.md | 8 + ...authverificationenterpriseaccountstatus.md | 10 + .../verificationoauthverificationobject.md | 8 + .../verificationoauthverificationstatus.md | 10 + docs/models/verificationobject.md | 8 + .../verificationotpverificationobject.md | 8 + .../verificationotpverificationstatus.md | 8 + .../verificationotpverificationstrategy.md | 10 + .../verificationpasskeyverificationobject.md | 8 + .../verificationpasskeyverificationstatus.md | 8 + ...verificationpasskeyverificationstrategy.md | 8 + ...samlverificationenterpriseaccountobject.md | 8 + ...samlverificationenterpriseaccountstatus.md | 8 + ...mlverificationenterpriseaccountstrategy.md | 8 + .../verificationsamlverificationobject.md | 8 + ...cationsamlverificationsamlaccountobject.md | 8 + ...cationsamlverificationsamlaccountstatus.md | 8 + ...tionsamlverificationsamlaccountstrategy.md | 8 + .../verificationsamlverificationstatus.md | 8 + .../verificationsamlverificationstrategy.md | 8 + docs/models/verificationstatus.md | 8 + docs/models/verificationstrategy.md | 10 + ...cketverificationenterpriseaccountobject.md | 8 + ...cketverificationenterpriseaccountstatus.md | 8 + ...etverificationenterpriseaccountstrategy.md | 10 + .../verificationticketverificationobject.md | 8 + ...tionticketverificationsamlaccountobject.md | 8 + ...tionticketverificationsamlaccountstatus.md | 8 + ...onticketverificationsamlaccountstrategy.md | 10 + .../verificationticketverificationstatus.md | 8 + .../verificationticketverificationstrategy.md | 10 + .../verificationweb3verificationobject.md | 8 + .../verificationweb3verificationstatus.md | 8 + .../verificationweb3verificationstrategy.md | 8 + docs/models/verified.md | 8 + docs/models/verifyapikeyobject.md | 8 + docs/models/verifym2mtokenobject.md | 8 + docs/models/waitlistentryinvitationobject.md | 8 + docs/models/waitlistentryinvitationstatus.md | 8 + docs/models/waitlistentryobject.md | 8 + docs/models/waitlistentrystatus.md | 8 + docs/models/web3walletobject.md | 8 + docs/sdks/agenttasks/README.md | 100 + docs/sdks/emailaddresses/README.md | 16 +- docs/sdks/instancesettingssdk/README.md | 83 + docs/sdks/m2m/README.md | 8 +- .../sdks/organizationinvitationssdk/README.md | 8 +- docs/sdks/organizationssdk/README.md | 103 +- docs/sdks/sessions/README.md | 5 +- docs/sdks/users/README.md | 101 +- pyproject.toml | 2 +- src/clerk_backend_api/_version.py | 6 +- src/clerk_backend_api/agenttasks.py | 402 ++++ src/clerk_backend_api/emailaddresses.py | 16 +- src/clerk_backend_api/instancesettings_sdk.py | 372 ++++ src/clerk_backend_api/m2m.py | 14 + src/clerk_backend_api/models/__init__.py | 231 +- src/clerk_backend_api/models/actortoken.py | 2 +- src/clerk_backend_api/models/adddomainop.py | 2 +- .../models/addrolestorolesetop.py | 2 +- .../models/adjustcreditbalancerequest.py | 61 + ...djustorganizationbillingcreditbalanceop.py | 30 + .../adjustuserbillingcreditbalanceop.py | 30 + src/clerk_backend_api/models/agenttask.py | 67 + .../models/allowlistidentifier.py | 2 +- .../models/billingpaymentattempt.py | 136 +- .../models/billingpriceresponse.py | 7 +- .../models/billingstatement.py | 11 +- .../models/blocklistidentifier.py | 2 +- .../cancelcommercesubscriptionitemop.py | 2 +- .../changeproductioninstancedomainop.py | 2 +- src/clerk_backend_api/models/clerkerror.py | 2 +- src/clerk_backend_api/models/client.py | 2 +- .../models/commercecreditbalanceresponse.py | 68 + .../models/commercecreditledgerresponse.py | 92 + .../models/commercepayerresponse.py | 2 +- .../models/commercepaymentmethodresponse.py | 2 +- .../models/commerceperunittotal.py | 30 + .../models/commerceperunittotaltier.py | 54 + src/clerk_backend_api/models/commerceplan.py | 10 +- .../models/commerceplanunitprice.py | 30 + .../models/commerceplanunitpricetier.py | 56 + .../models/commercepricetransitiondetails.py | 2 +- .../models/commercesubscription.py | 2 +- .../commercesubscriptioncreditresponse.py | 2 +- .../models/commercesubscriptionitem.py | 232 +- .../models/createactortokenop.py | 2 +- .../models/createagenttaskop.py | 128 ++ .../models/createallowlistidentifierop.py | 2 +- .../models/createapikeyop.py | 4 +- .../models/createbillingpricerequest.py | 2 +- .../models/createbulkinvitationsop.py | 2 +- .../models/createbulkwaitlistentriesop.py | 2 +- .../models/createemailaddressop.py | 2 +- .../models/createinvitationop.py | 2 +- .../models/createjwttemplateop.py | 2 +- .../models/createm2mtokenop.py | 14 +- .../models/createmachineop.py | 2 +- .../models/createmachinescopeop.py | 2 +- .../models/createoauthapplicationop.py | 2 +- .../models/createorganizationdomainop.py | 2 +- .../createorganizationinvitationbulkop.py | 2 +- .../models/createorganizationinvitationop.py | 4 +- .../models/createorganizationmembershipop.py | 2 +- .../models/createorganizationop.py | 2 +- .../models/createorganizationpermissionop.py | 2 +- .../models/createorganizationroleop.py | 2 +- .../models/createphonenumberop.py | 2 +- .../models/createrolesetop.py | 2 +- .../models/createsamlconnectionop.py | 8 +- .../models/createsessionop.py | 2 +- .../createsessiontokenfromtemplateop.py | 6 +- .../models/createsessiontokenop.py | 6 +- .../models/createsignintokenop.py | 2 +- src/clerk_backend_api/models/createuserop.py | 2 +- .../models/createwaitlistentryop.py | 2 +- .../models/deletebackupcodeop.py | 2 +- src/clerk_backend_api/models/deletedobject.py | 2 +- src/clerk_backend_api/models/deletetotpop.py | 2 +- src/clerk_backend_api/models/disablemfaop.py | 2 +- src/clerk_backend_api/models/domain.py | 2 +- src/clerk_backend_api/models/emailaddress.py | 18 +- .../models/enterpriseaccount.py | 16 +- .../models/externalaccountwithverification.py | 12 +- .../models/featureresponse.py | 2 +- src/clerk_backend_api/models/getapikeyop.py | 2 +- src/clerk_backend_api/models/getapikeysop.py | 4 +- .../models/getbillingpricelistop.py | 2 +- .../models/getbillingstatementlistop.py | 2 +- .../getbillingstatementpaymentattemptsop.py | 2 +- .../models/getclientlistop.py | 2 +- .../models/getcommerceplanlistop.py | 2 +- .../getcommercesubscriptionitemlistop.py | 2 +- .../models/getm2mtokensop.py | 4 +- .../models/getoauthaccesstokenop.py | 2 +- .../getorganizationbillingcreditbalanceop.py | 18 + .../models/getorganizationop.py | 2 +- .../models/getpublicinterstitialop.py | 2 +- .../models/getsessionlistop.py | 2 +- .../models/gettemplatelistop.py | 2 +- .../models/getuserbillingcreditbalanceop.py | 18 + src/clerk_backend_api/models/getuserlistop.py | 2 +- .../models/getuserscountop.py | 2 +- src/clerk_backend_api/models/instance.py | 2 +- .../instancegetorganizationmembershipsop.py | 2 +- .../models/instancesettings.py | 2 +- src/clerk_backend_api/models/invitation.py | 2 +- .../models/invitation_revoked.py | 2 +- .../models/invitewaitlistentryop.py | 4 +- src/clerk_backend_api/models/jwks.py | 4 +- .../models/listallorganizationdomainsop.py | 2 +- .../models/listallowlistidentifiersop.py | 2 +- .../listinstanceorganizationinvitationsop.py | 3 +- .../models/listinvitationsop.py | 2 +- .../models/listjwttemplatesop.py | 2 +- .../models/listmachinesop.py | 2 +- .../models/listoauthapplicationsop.py | 2 +- .../models/listorganizationdomainsop.py | 2 +- .../models/listorganizationinvitationsop.py | 3 +- .../models/listorganizationmembershipsop.py | 2 +- .../models/listorganizationpermissionsop.py | 2 +- .../models/listorganizationrolesop.py | 2 +- .../models/listorganizationsop.py | 2 +- .../listpendingorganizationinvitationsop.py | 2 +- .../models/listredirecturlsop.py | 2 +- .../models/listrolesetsop.py | 2 +- .../models/listsamlconnectionsop.py | 2 +- .../models/listwaitlistentriesop.py | 2 +- src/clerk_backend_api/models/machine.py | 2 +- .../models/machine_created.py | 2 +- .../models/machinewithoutscopedmachines.py | 2 +- .../models/mergeorganizationmetadataop.py | 2 +- .../models/oauthaccesstoken.py | 2 +- .../models/oauthapplication.py | 2 +- .../models/oauthapplicationsettings.py | 36 + .../models/oauthapplicationwithsecret.py | 2 +- src/clerk_backend_api/models/organization.py | 2 +- .../models/organizationdomain.py | 6 +- .../models/organizationinvitation.py | 2 +- ...izationinvitationpublicorganizationdata.py | 2 +- .../organizationinvitationpublicuserdata.py | 2 +- ...ioninvitationwithpublicorganizationdata.py | 2 +- .../models/organizationmembership.py | 4 +- .../organizationmembershippublicuserdata.py | 2 +- .../models/organizationsettings.py | 2 +- .../models/organizationwithlogo.py | 2 +- src/clerk_backend_api/models/passkey.py | 4 +- src/clerk_backend_api/models/phonenumber.py | 6 +- .../models/previewtemplateop.py | 4 +- src/clerk_backend_api/models/proxycheck.py | 2 +- .../models/refreshsessionop.py | 4 +- .../models/replacerolesetop.py | 2 +- .../models/revokeagenttaskop.py | 18 + .../models/revokeapikeyop.py | 4 +- .../models/revokem2mtokenop.py | 4 +- .../models/revokeorganizationinvitationop.py | 4 +- src/clerk_backend_api/models/role.py | 2 +- src/clerk_backend_api/models/roleset.py | 8 +- src/clerk_backend_api/models/rolesetitem.py | 2 +- src/clerk_backend_api/models/samlaccount.py | 12 +- .../models/schemas_commerceplan.py | 2 +- .../schemas_commercesubscriptionitem.py | 14 +- .../models/schemas_samlconnection.py | 4 +- src/clerk_backend_api/models/security.py | 2 +- src/clerk_backend_api/models/session.py | 2 +- .../models/sessionactivityresponse.py | 2 +- .../models/setuserpasswordcompromisedop.py | 4 +- .../models/setuserprofileimageop.py | 4 +- src/clerk_backend_api/models/signintoken.py | 2 +- src/clerk_backend_api/models/signup.py | 2 +- .../models/signupverification.py | 4 +- .../models/signupverifications.py | 2 +- src/clerk_backend_api/models/template.py | 2 +- .../models/toggletemplatedeliveryop.py | 4 +- .../models/updateapikeyop.py | 4 +- .../models/updatedomainop.py | 2 +- .../models/updateemailaddressop.py | 4 +- .../models/updateinstanceauthconfigop.py | 2 +- ...pdateinstanceoauthapplicationsettingsop.py | 56 + .../models/updateinstanceop.py | 2 +- .../updateinstanceorganizationsettingsop.py | 2 +- .../models/updateinstanceprotectop.py | 2 +- .../models/updateinstancerestrictionsop.py | 2 +- .../models/updatejwttemplateop.py | 4 +- .../models/updatemachineop.py | 4 +- .../models/updateoauthapplicationop.py | 2 +- .../models/updateorganizationdomainop.py | 2 +- .../updateorganizationmembershipmetadataop.py | 4 +- .../models/updateorganizationop.py | 2 +- .../models/updateorganizationpermissionop.py | 2 +- .../models/updateorganizationroleop.py | 2 +- .../models/updatephonenumberop.py | 4 +- .../updateproductioninstancedomainop.py | 2 +- .../models/updaterolesetop.py | 2 +- .../models/updatesamlconnectionop.py | 4 +- .../models/updatesignupop.py | 4 +- .../models/updateusermetadataop.py | 4 +- src/clerk_backend_api/models/updateuserop.py | 2 +- .../models/uploadorganizationlogoop.py | 6 +- .../models/upserttemplateop.py | 4 +- src/clerk_backend_api/models/user.py | 2 +- .../usersgetorganizationinvitationsop.py | 3 +- .../usersgetorganizationmembershipsop.py | 2 +- .../models/verifyapikeyop.py | 2 +- .../models/verifydomainproxyop.py | 2 +- .../models/verifym2mtokenop.py | 2 +- .../models/verifyoauthaccesstokenop.py | 4 +- .../models/verifypasswordop.py | 4 +- src/clerk_backend_api/models/verifytotpop.py | 4 +- src/clerk_backend_api/models/waitlistentry.py | 4 +- src/clerk_backend_api/models/web3wallet.py | 6 +- .../organizationinvitations_sdk.py | 8 +- src/clerk_backend_api/organizations_sdk.py | 470 +++- src/clerk_backend_api/sdk.py | 5 +- src/clerk_backend_api/sessions.py | 10 +- src/clerk_backend_api/users.py | 470 +++- 459 files changed, 7092 insertions(+), 1228 deletions(-) create mode 100644 docs/models/action.md create mode 100644 docs/models/adjustcreditbalancerequest.md create mode 100644 docs/models/adjustorganizationbillingcreditbalancerequest.md create mode 100644 docs/models/adjustuserbillingcreditbalancerequest.md create mode 100644 docs/models/agenttask.md create mode 100644 docs/models/agenttaskobject.md create mode 100644 docs/models/balance.md create mode 100644 docs/models/billingpaymentattemptcredits.md create mode 100644 docs/models/billingpaymentattemptpayer.md create mode 100644 docs/models/billingpaymentattemptproration.md create mode 100644 docs/models/billingpaymentattempttotals.md create mode 100644 docs/models/billingstatementtotals.md create mode 100644 docs/models/commercecreditbalanceresponse.md create mode 100644 docs/models/commercecreditledgerresponse.md create mode 100644 docs/models/commerceperunittotal.md create mode 100644 docs/models/commerceperunittotaltier.md create mode 100644 docs/models/commerceplanunitprice.md create mode 100644 docs/models/commerceplanunitpricetier.md create mode 100644 docs/models/commercesubscriptionitemcredits.md create mode 100644 docs/models/commercesubscriptionitempayer.md create mode 100644 docs/models/commercesubscriptionitemproration.md create mode 100644 docs/models/commercesubscriptionitemtotalspayer.md create mode 100644 docs/models/createagenttaskpermissions.md create mode 100644 docs/models/createagenttaskrequestbody.md create mode 100644 docs/models/credits.md create mode 100644 docs/models/getorganizationbillingcreditbalancerequest.md create mode 100644 docs/models/getuserbillingcreditbalancerequest.md create mode 100644 docs/models/oauthapplicationsettings.md create mode 100644 docs/models/oauthapplicationsettingsobject.md create mode 100644 docs/models/onbehalfof.md create mode 100644 docs/models/proration.md create mode 100644 docs/models/revokeagenttaskrequest.md create mode 100644 docs/models/seats.md create mode 100644 docs/models/tokenformat.md create mode 100644 docs/models/updateinstanceoauthapplicationsettingsrequestbody.md create mode 100644 docs/sdks/agenttasks/README.md create mode 100644 src/clerk_backend_api/agenttasks.py create mode 100644 src/clerk_backend_api/models/adjustcreditbalancerequest.py create mode 100644 src/clerk_backend_api/models/adjustorganizationbillingcreditbalanceop.py create mode 100644 src/clerk_backend_api/models/adjustuserbillingcreditbalanceop.py create mode 100644 src/clerk_backend_api/models/agenttask.py create mode 100644 src/clerk_backend_api/models/commercecreditbalanceresponse.py create mode 100644 src/clerk_backend_api/models/commercecreditledgerresponse.py create mode 100644 src/clerk_backend_api/models/commerceperunittotal.py create mode 100644 src/clerk_backend_api/models/commerceperunittotaltier.py create mode 100644 src/clerk_backend_api/models/commerceplanunitprice.py create mode 100644 src/clerk_backend_api/models/commerceplanunitpricetier.py create mode 100644 src/clerk_backend_api/models/createagenttaskop.py create mode 100644 src/clerk_backend_api/models/getorganizationbillingcreditbalanceop.py create mode 100644 src/clerk_backend_api/models/getuserbillingcreditbalanceop.py create mode 100644 src/clerk_backend_api/models/oauthapplicationsettings.py create mode 100644 src/clerk_backend_api/models/revokeagenttaskop.py create mode 100644 src/clerk_backend_api/models/updateinstanceoauthapplicationsettingsop.py diff --git a/.speakeasy/gen.lock b/.speakeasy/gen.lock index 3770d221..4a8a2a47 100644 --- a/.speakeasy/gen.lock +++ b/.speakeasy/gen.lock @@ -1,41 +1,41 @@ lockVersion: 2.0.0 id: bfe29c99-6e67-43fe-b928-64d6a5ed6aa8 management: - docChecksum: 665d6da5d96cfc98d2d9289b84659745 + docChecksum: b20699e31cd4253e9aa18d4adf166e55 docVersion: "2025-11-10" - speakeasyVersion: 1.722.7 - generationVersion: 2.832.9 - releaseVersion: 5.0.2 - configChecksum: 9a2bd40b9795fbb0b8d56608b48248d4 + speakeasyVersion: 1.749.0 + generationVersion: 2.855.2 + releaseVersion: 5.0.3 + configChecksum: 42e631682e52af7a883788bf9fc01fc2 repoURL: https://github.com/clerk/clerk-sdk-python.git installationURL: https://github.com/clerk/clerk-sdk-python.git published: true persistentEdits: - generation_id: e80a0e83-2313-4c93-b729-5b688a5ab852 - pristine_commit_hash: 11eae038f17d768e06fed4747995c38fa73cab3e - pristine_tree_hash: 696015662c12668904310b17fa031884c9e5f49c + generation_id: f482a1e7-81a4-469a-b7c6-75e563e58cc9 + pristine_commit_hash: a9f95a9d9b896d3aa7179fe5e50bbdb72959b75b + pristine_tree_hash: 7a00d3b388f4acd9e5561f0fff608dad8a949346 features: python: additionalDependencies: 1.0.0 additionalProperties: 1.0.1 - constsAndDefaults: 1.0.6 - core: 6.0.11 + constsAndDefaults: 1.0.7 + core: 6.0.16 customCodeRegions: 0.1.1 defaultEnabledRetries: 0.2.0 deprecations: 3.0.2 - enumUnions: 0.1.0 + enumUnions: 0.1.1 envVarSecurityUsage: 0.3.2 - examples: 3.0.2 + examples: 3.0.3 flatRequests: 1.0.1 flattening: 3.1.1 globalSecurity: 3.0.5 globalSecurityCallbacks: 1.0.0 globalSecurityFlattening: 1.0.0 - globalServerURLs: 3.2.0 + globalServerURLs: 3.2.1 groups: 3.0.1 methodArguments: 1.0.2 multipartFileContentType: 1.0.0 - nameOverrides: 3.0.1 + nameOverrides: 3.0.3 nullables: 1.0.2 openEnums: 1.0.4 responseFormat: 1.1.0 @@ -56,6 +56,10 @@ trackedFiles: id: 3aed33ce6e6f last_write_checksum: sha1:92dcd42f856595bb950069d4eeb367c87e49d836 pristine_git_object: 4639eab7f56e7168d92efbe988b76758fe0bbb6d + docs/models/action.md: + id: 3b583d6a609e + last_write_checksum: sha1:1f1ba56533f47f72172343331d37579299c437a2 + pristine_git_object: 9533c7e42f18303a08f1cb059921c8805beb9e84 docs/models/actor.md: id: 206a38367ba1 last_write_checksum: sha1:14019a6d7336764641d0ae57c367e640f87a0da3 @@ -70,12 +74,12 @@ trackedFiles: pristine_git_object: 16e49d42c2084b12359f97f205d77355153c05ce docs/models/actortokenobject.md: id: e6ab85f32ea6 - last_write_checksum: sha1:f379cd37e97fd8284b4e531fcbc81a4da90599b7 - pristine_git_object: 354c3afc7f52bb290ad74eb8200e673edacf6640 + last_write_checksum: sha1:3f9c3094376d54dfa05c5ff94c0d7c2b5541ea79 + pristine_git_object: 2b8e58badd812172523d0471e03c85188631593d docs/models/actortokenstatus.md: id: dbc996dd78d9 - last_write_checksum: sha1:c77ccf2405c1c4af5e26c1c69c7f6429169b456f - pristine_git_object: f7dd5772fe5917a8d4d3ae5352e039614712a0b6 + last_write_checksum: sha1:6ef9e907ce6a1e6349b207918e5b4ae22130c706 + pristine_git_object: 01c5c2da7f786fbb9b02c42e30ff791b8cad4885 docs/models/adddomainrequestbody.md: id: ca45ef327f10 last_write_checksum: sha1:16498328861fbc9d2d338377144a328378ba1f91 @@ -88,18 +92,38 @@ trackedFiles: id: 5edda3a527f3 last_write_checksum: sha1:22ceb69d7787c3e7fc7e3cfc307b6d35dea0bd00 pristine_git_object: faa7449f8505c6513777c11dcab1ce425a43b842 + docs/models/adjustcreditbalancerequest.md: + id: c32f18513d95 + last_write_checksum: sha1:53b50e875f034eb0330b7bed15a5d299f2b58824 + pristine_git_object: 93b7767922e49990876a1a50c88f343791bc5206 + docs/models/adjustorganizationbillingcreditbalancerequest.md: + id: 8023be7a37a8 + last_write_checksum: sha1:494821eb9660c0b65464cf5d33029ff348e7c64f + pristine_git_object: 35997453bc3b04f5f5e6153dbc61031a7a9d0139 + docs/models/adjustuserbillingcreditbalancerequest.md: + id: 9d5db220566f + last_write_checksum: sha1:0147622f3f2f4b5fb5bd708aacd36a8ae4383338 + pristine_git_object: de4790f19635a30f6d597fb06274858f195827e1 docs/models/admin.md: id: 901b28ee785f last_write_checksum: sha1:f9a9ec7079fb6391aa0cffe100cac8b146b46db3 pristine_git_object: 758c005e673e124a8ea599cad785a42ed23f4dde + docs/models/agenttask.md: + id: a41b99322257 + last_write_checksum: sha1:1ae563b8e96d875bb286b8e0e4a78e5d9a2f07ee + pristine_git_object: 686502d871c8934c3c6bc5bac38e3968a645749d + docs/models/agenttaskobject.md: + id: fac60e8adb3d + last_write_checksum: sha1:c33bd89a7ffbf2822c835bc1e73f508511c2f896 + pristine_git_object: f39699708e00bfa21e80de38aa17a83ad7109f36 docs/models/allowlistidentifier.md: id: 2324c8a02b04 last_write_checksum: sha1:22944e671dfd04074cdd8c852eb98c3a91cbf7e2 pristine_git_object: 82a8f58137706097392c43da59b145cd477e1090 docs/models/allowlistidentifierobject.md: id: e3c18fbce783 - last_write_checksum: sha1:9b14ae26826a22a77a9113d0190b61ac76c9a66f - pristine_git_object: 5473a90a45b0db8bda88a7f5c9bd4b39427d11e0 + last_write_checksum: sha1:14f1596d48c445467f68a0b1ce1618c4788fc7cd + pristine_git_object: aff706fe3b5af896463ef16873d2f1f8ee26e357 docs/models/amount.md: id: 437bf42a480e last_write_checksum: sha1:2ed0f0910cf969bc42c47c64b5a61699f161da34 @@ -120,58 +144,82 @@ trackedFiles: id: fb5d1e88accb last_write_checksum: sha1:ba49223ef048a6838f8a8047b51aede392372c3f pristine_git_object: 485ed65f7bf554c5e5c564ba7e60bfbb95fa9f4b + docs/models/balance.md: + id: 9de59403580f + last_write_checksum: sha1:245fc1de014969c5802cb417b69e53ab37c5fb03 + pristine_git_object: 47f6b2c275d5f28cb6fd223f2ad9d1ce3cfe7d68 docs/models/banuserrequest.md: id: d3d7f94c29c0 last_write_checksum: sha1:36c9af5adbb73be90fcc9d9117fc1335788aa273 pristine_git_object: 950073548836af65f73d24063050b33aff46ca61 docs/models/billingpaymentattempt.md: id: 7ef2b59c7544 - last_write_checksum: sha1:29928d50d4ce12f95ce98d47fc424d2e91602380 - pristine_git_object: ff67b3c8c2893bffc4fd33ea931bab13508d0bc6 + last_write_checksum: sha1:b85c698bb4356d396cd8c7600027d57b2dd1e6d0 + pristine_git_object: a59dd421505207a6e33a66a2379a7cfe67d1c8a6 + docs/models/billingpaymentattemptcredits.md: + id: 4a4990331020 + last_write_checksum: sha1:61b7e4108920d55451f0a1b35fa91eae59e43b18 + pristine_git_object: 231c86968c957cf78175da26b792f73e497ee3cf docs/models/billingpaymentattemptobject.md: id: 0fd087a97257 - last_write_checksum: sha1:a3e495d39f36d3b3459b4f8044dfcb4c8262a5c8 - pristine_git_object: 878a0252d4c06683e12533df1470727b7a330f3d + last_write_checksum: sha1:d848fa122ab9a2d373c9323cc6dacdbbad2b964d + pristine_git_object: d7b527371bd517f3c0c94c9ba61c6aa419502992 + docs/models/billingpaymentattemptpayer.md: + id: b1df28363436 + last_write_checksum: sha1:455b127f52c928fc1abd5ba33d6c802396e762b6 + pristine_git_object: 84e64a6dd0b995826eeb6728fd0f83cf9877028c + docs/models/billingpaymentattemptproration.md: + id: 74cbc9c1f3c6 + last_write_checksum: sha1:4802d276de45c66b63e00aef758bd1955b9b5be2 + pristine_git_object: b83e2b075fd62bb5789b5eebd5476b233c8e286e docs/models/billingpaymentattemptstatus.md: id: ee76a38ed58c - last_write_checksum: sha1:d4b2610bcfd0f46b0250b509f472836184f4f7a4 - pristine_git_object: 2f1aee48e970b31d6592ce9de3d7692f74897425 + last_write_checksum: sha1:0d90fc1f07d045a25daa1bd9de87fd3b23cf178b + pristine_git_object: 65d23f4eb6988b3cc8bbc4aabd174c569ad9bdb4 + docs/models/billingpaymentattempttotals.md: + id: 3d831529d162 + last_write_checksum: sha1:2ec0bebe4779c6633a50e9d8c8117d051ec7316a + pristine_git_object: 04e35934aab98b338857a0703bd22e7a3d12cd4b docs/models/billingpriceresponse.md: id: db38a8f67a7b - last_write_checksum: sha1:5536223a0bdbd90edbc4f503f53cdf18da37175d - pristine_git_object: f414141ad0bfa94e51738710540c4dce52946630 + last_write_checksum: sha1:10cc2f9f6aa4b01fa5c43639573693355c36fde6 + pristine_git_object: 03d82b3cfae3f9503e8433ac3c689632603556d5 docs/models/billingpriceresponseobject.md: id: 3c0f3c31ffb4 - last_write_checksum: sha1:ddfca254634407ef3987df8bbbca8acd723185b0 - pristine_git_object: d19b4d874ea1b14dd56a0fdc97185844fc569525 + last_write_checksum: sha1:da10dc26785b9e9e61cae3375429d788cccea83b + pristine_git_object: c9b52fafe9cbaa8eedfccced86ac94dba8bf7c55 docs/models/billingstatement.md: id: b7c638eadb6c - last_write_checksum: sha1:15a2ea73740dbb0ff1b990eeee6afbc94320435a - pristine_git_object: 3260886986f123859f7edf00996a51897057e6e3 + last_write_checksum: sha1:bb87c24ce21e9bdb52bf004c23fff52587419b61 + pristine_git_object: 3827784b3c71a6dc5532090a4a852fbbb1416adb docs/models/billingstatementgroupsobject.md: id: 7fca9d8db6d2 - last_write_checksum: sha1:7c7426cf6f8f9c3337ed6a969c2398cabb9e0632 - pristine_git_object: 064ebf0dbb5200a9e62196674a03af91e1dfc891 + last_write_checksum: sha1:cb4b74a1e46bab53e78149fe9224ad852f0f7470 + pristine_git_object: b0d031820dac799cb9e612980fb0942a5795aed7 docs/models/billingstatementobject.md: id: bbb9b504a639 - last_write_checksum: sha1:40118075bfcd0ab9d7410f42c797aadfb1312834 - pristine_git_object: f7f30f33b5940f588ba05b56a872999a0b0a7cf8 + last_write_checksum: sha1:cb5c0bf5c7927df270eb93476ed9f71aeb988b57 + pristine_git_object: f434140137562aba25fe9ac0a3308977901236e1 docs/models/billingstatementstatus.md: id: 460a461ca847 - last_write_checksum: sha1:432d02744da8fdc1bf3413cd4c006c09d93eb55f - pristine_git_object: fd265e1413bc79cdec36df8b03acdfe3d001c9ac + last_write_checksum: sha1:13b0b9a2823ff7129f90f5b7e27e5c728047fdd6 + pristine_git_object: 3cfa0ddf747ada60a5d30ee4d8da03132769ba6d + docs/models/billingstatementtotals.md: + id: 1f4c8193dd36 + last_write_checksum: sha1:c0b1f2682e16660c80798fd317596ec5cbc8f750 + pristine_git_object: 4e5ef1930bc9c9075b9b4cb0ab35dffcc6fa383a docs/models/blocklistidentifier.md: id: 065341f0dc2c last_write_checksum: sha1:5b4311c5bc7864c5d002fc8707a722e70ec14ac4 pristine_git_object: a5ddaea61905fac2560b70a71911057976814ec8 docs/models/blocklistidentifieridentifiertype.md: id: e0d79c667e2b - last_write_checksum: sha1:5e6273d2a1eca582cb0170bd4b3be0c83ccd7fae - pristine_git_object: 21f7db061c00c964da91d5a1c6067c7578dd0623 + last_write_checksum: sha1:12cffd5d6a599df40784f74cb5eeb4cc9cdaa3ac + pristine_git_object: 0709a80be6bfaa49d369324ee9fcdca29ed0ee4a docs/models/blocklistidentifierobject.md: id: ac297d5201e4 - last_write_checksum: sha1:d9cabf97b688bde9781c04c86fe8bedbc1244645 - pristine_git_object: 9efb8aff8fc89c7e19bf23adb73c7be062c37ec9 + last_write_checksum: sha1:2151d6704ff7a725e1b6a562b6251d111fc5877b + pristine_git_object: e33f9f8f34b2d4e845154ced70d85c39e54d414f docs/models/blocklistidentifiers.md: id: 91ee2feeba95 last_write_checksum: sha1:005427e1da14fccef9fad96b4d03a92b8fe57761 @@ -234,8 +282,16 @@ trackedFiles: pristine_git_object: d9f987dd71d638f75cc5eb039f697ec8d8275f49 docs/models/codetype.md: id: 4465d34f2239 - last_write_checksum: sha1:391cce46065e8560f609c785cda2fef7f369561e - pristine_git_object: e3d81ceaeb0b48cd0d93d94c57ba78923c1af162 + last_write_checksum: sha1:762c329134e6fa4dd5b120fad16758ca57d5d74e + pristine_git_object: d394be1c6ff17175e16e7eefcbfbea12af28fdda + docs/models/commercecreditbalanceresponse.md: + id: bde4e382e5f1 + last_write_checksum: sha1:6801fc5ff4ab3b9430bed22ab127cd8f719167ca + pristine_git_object: ce6bac51471f8ea5afb426d78ba6eb5eb8908e15 + docs/models/commercecreditledgerresponse.md: + id: c10a47febf1e + last_write_checksum: sha1:808f701a75f0a16b5dad026935c8aa3b5b8f1c56 + pristine_git_object: a3105d238fcd210304dbb96c5dde4a43cbb8bd67 docs/models/commercemoneyresponse.md: id: 1c98825160a2 last_write_checksum: sha1:9bfac9d7136d4aa0c1e251f88c11e6c6acacb1f4 @@ -246,28 +302,44 @@ trackedFiles: pristine_git_object: 0a9e2e2d61e149361e489aea14aefdf59cbeda4c docs/models/commercepayerresponseobject.md: id: ea24db598844 - last_write_checksum: sha1:352aa7675bc27d411e01f6a1b5838f084a374154 - pristine_git_object: 248edd78a2c9cfbc981ec8a32b91a0d0f0d0fa38 + last_write_checksum: sha1:b4c84213452013259a5590d0c16a63d46d487041 + pristine_git_object: f96b8ccc11bcb0e4dd1adc7cfdaea2401a32e00a docs/models/commercepaymentmethodresponse.md: id: f5318099c26b last_write_checksum: sha1:aa0b0b2aab630ecff7b7b5f6e2c6bc27fd3bdb40 pristine_git_object: 505dfa0a15a4ea864b99713870e87155bde786f2 docs/models/commercepaymentmethodresponseobject.md: id: 5c9d53554a46 - last_write_checksum: sha1:faa6359103cfb5b60d18d643f0e3586ada3810b9 - pristine_git_object: 9ba6b3b774896b920de9e98faa5f4c86e1009703 + last_write_checksum: sha1:e4e569db824c1a9a809839a56987e1d026f61de0 + pristine_git_object: 642e92734dfac2cd257bdf1bc7c7c9cf79349fc6 docs/models/commercepaymentmethodresponsestatus.md: id: 6bf1ab740a3f - last_write_checksum: sha1:a40d031d79731fae9cb617b6fe2a9bfc5aade2cb - pristine_git_object: 578c6aaa3130675bc6f052bc8ef3be2772d04a97 + last_write_checksum: sha1:0beb122a7003568c89a66e19d40f32913e649685 + pristine_git_object: 5b8a2c95e55d070c8c31b8c3e5d328321ffeb3a0 + docs/models/commerceperunittotal.md: + id: c76f471b5964 + last_write_checksum: sha1:c8244b68a0262d98d74e46fb559a02be3ac3d1a7 + pristine_git_object: 8b90180c2af9a06cf68f8f74642eace5b03c352b + docs/models/commerceperunittotaltier.md: + id: c6740d0c9d6a + last_write_checksum: sha1:e8ed2e41911dd6d2b3c37d111325420caea8a8ce + pristine_git_object: 65998837eabdff7b04a6689e41a1a6201b45af3d docs/models/commerceplan.md: id: 02500030883c - last_write_checksum: sha1:5244d6214db10b30c92f1ae20f55fb12450621f5 - pristine_git_object: b06af6d1f5a374dc1bd5fab857c325e56ca2447f + last_write_checksum: sha1:b95847038e36e48007fb4f9585f0d156b41c5d8a + pristine_git_object: bc5f02a0e047fc2154bda86c6a586220536585b4 docs/models/commerceplanobject.md: id: 01a815f37af4 - last_write_checksum: sha1:f90bc321fcc4abe06d5476ec4d163fbda69eb4f3 - pristine_git_object: 5fd27e3ccc4530897406ac6eafe078f924880a15 + last_write_checksum: sha1:85b9dabc3838f6aa06ce6e023166adf8839a8bc2 + pristine_git_object: abf478d5821273c7ba36f90bdf5caa9dc85d0057 + docs/models/commerceplanunitprice.md: + id: b17dbeb6c8b2 + last_write_checksum: sha1:344974eec3530257049785ca2a9e8337f1d5ab4b + pristine_git_object: 487ceb10810fe57702e54e8860a198429eb580cf + docs/models/commerceplanunitpricetier.md: + id: b427a64df4a7 + last_write_checksum: sha1:6f4bbc6d60fad908b43f0adf34a8fe1fdb724351 + pristine_git_object: 1863c805196bc2acb71a19bf74d48c37e60ca68e docs/models/commercepricetransitiondetails.md: id: e1a67a698e50 last_write_checksum: sha1:b5db8bb2441cedbdcaeb325ed229841eb2ba67bb @@ -278,8 +350,8 @@ trackedFiles: pristine_git_object: 04213ba41b25a60af45b1ebd3600434bf07b21c3 docs/models/commercepricetransitionresponseobject.md: id: 47ce4b946ed3 - last_write_checksum: sha1:34fd99a44eb0a2a873a3b8e19beff20a4bd4cf9a - pristine_git_object: bcf5af7b527692d707be311cb3e516fe3b07ed4d + last_write_checksum: sha1:b1088b3258dc6987a4193afd77c1bb4d264302fc + pristine_git_object: f14e5ab6fc89bfb7c10b9dffd93a520e29a68e9f docs/models/commercesubscription.md: id: 361cee759b70 last_write_checksum: sha1:9094c0aa0f7ce392f9ee1475c0a05546872e2c01 @@ -290,8 +362,8 @@ trackedFiles: pristine_git_object: 65b9e27bfbecf38f0bb384d20d9cc049fe510947 docs/models/commercesubscriptionitem.md: id: b9fbc7f15c99 - last_write_checksum: sha1:5aa1753f2f6f06fba4bb0eec5f1907c077b27151 - pristine_git_object: da17de960d46b2b7a171d24bab56befa56824590 + last_write_checksum: sha1:50701b404c25a7fa7308c16c4470b23fa52a002a + pristine_git_object: d5a9f4bfbf14c21f35aa54b1f2210ffd05bf5e46 docs/models/commercesubscriptionitemamount.md: id: 1707cf10af87 last_write_checksum: sha1:c7e591e269ada11d072bae979c33fc4d9d4a2591 @@ -304,38 +376,54 @@ trackedFiles: id: "765163103103" last_write_checksum: sha1:8d6929a88889acc68608b0c91448e46243dd333e pristine_git_object: 9d5fad82956c766f3cdf0f0ce931a31a4d43df49 + docs/models/commercesubscriptionitemcredits.md: + id: 1a628479fb20 + last_write_checksum: sha1:b046cf3a742bc064f66ecaf9938b8887eb5d5ec3 + pristine_git_object: e0c9f112de5814eee3eb311a9126ae128340b831 docs/models/commercesubscriptionitemobject.md: id: 7c4b622b9a11 - last_write_checksum: sha1:315d4d38e5d5eed3dd63653e3106267983cc0da9 - pristine_git_object: 25773afbd68f9207baa9af5680433c6362f3fff3 + last_write_checksum: sha1:00dda43c1119b964bcba4927fb648d5d7a30783d + pristine_git_object: d0f618bed05a8bcd29a28a14d7ef6e590ed49229 + docs/models/commercesubscriptionitempayer.md: + id: 0dabd6dd1f13 + last_write_checksum: sha1:bbf52d054221a9be0b79906b016f7ab3e931c3a5 + pristine_git_object: 9e3c4d23b33b65b76b9a557bc6c6952ffe8300cb docs/models/commercesubscriptionitemplanobject.md: id: 3074cceb2655 - last_write_checksum: sha1:430266403255ddbf7d9a093a1b6a0859a6adc84b - pristine_git_object: 1a050d3f1360fb707efb09308ff871c4ae889ab0 + last_write_checksum: sha1:ab4d0a1f92ac8d0ce41b1742adf245d1b5b61798 + pristine_git_object: 9fe1fe9413edfd4e2b1280e88ff83979424f6f5f + docs/models/commercesubscriptionitemproration.md: + id: 05e0709d33df + last_write_checksum: sha1:947bbef5e7583532727b0bcb3f84d32a5750e477 + pristine_git_object: 614dd62c837ac36491e053fd51aea47aab73003d docs/models/commercesubscriptionitemstatus.md: id: de228e46e771 - last_write_checksum: sha1:88e6db6c57c8ac8bd39130c0bbdf7acf3bce432d - pristine_git_object: 89b8ee8136348fd5db98934ec0217ba3274152dd + last_write_checksum: sha1:6fb633bd78be6881d2e9ca79a602e1edcd9d0fec + pristine_git_object: 1723fa0ecf98b712a5450452d0a5b8cfba9fd105 + docs/models/commercesubscriptionitemtotalspayer.md: + id: 5834ac21e8a8 + last_write_checksum: sha1:0d18d0b6f829fbb96853ce47d5b84faf98aa3bbd + pristine_git_object: aeadac9cb6848bc922ea803653db80dc892cb486 docs/models/commercesubscriptionnextpayment.md: id: 79fbdadb72f4 last_write_checksum: sha1:603f9441ff8c12ac6c7e286493731465e2282343 pristine_git_object: db7ff866272749c683f8c248885111d29b2ddb17 docs/models/commercesubscriptionobject.md: id: 562480f5fd31 - last_write_checksum: sha1:065ed61cdad75e02b4f04a49e0ce7c6824112b3c - pristine_git_object: 3bf28a602d462a1372e30450b707b56ef41453dd + last_write_checksum: sha1:7caa9a0ab536285ae3cd6d1c40632a442a2d99f8 + pristine_git_object: 2c7b7113d5a683a8b0d06ced8487a99c13dbaa63 docs/models/commercesubscriptionstatus.md: id: 09d72064112c - last_write_checksum: sha1:52dc7b446bf2268d45563db4f19b1b1c7c876a47 - pristine_git_object: 252abe0b818364fffc76764f477f7f7d10070c9c + last_write_checksum: sha1:ba24e69a299fd05b87dcbb852facd72e7bd6bb25 + pristine_git_object: 9fb3356e277a9a51cc65df1d85e1246c95ad98e0 docs/models/cookies.md: id: 39960540a349 last_write_checksum: sha1:263a0c18d641e4f3d468c8f1eba9e916b8346125 pristine_git_object: 13a917ab854c0401e26b749bef7b7070ce37d123 docs/models/cookiesobject.md: id: 41c4957fa62a - last_write_checksum: sha1:168af5ab94523a5188af0c17ea3a0589e6c135ed - pristine_git_object: df0347f176ad60a062575683ba57878573d996b2 + last_write_checksum: sha1:5b648b839da1ea53723b6350dcb5d543ea4206ba + pristine_git_object: f48c7008f1048cecd9c922ec783d3b36909eba32 docs/models/createactortokenactor.md: id: 70946623e548 last_write_checksum: sha1:28b4c416bf1a72a93e7c03609882fb77980ba4af @@ -344,6 +432,14 @@ trackedFiles: id: 9d6a84b188ed last_write_checksum: sha1:b2ab64a9ef5e10c98e9de3dfe36c845ca3cd149d pristine_git_object: b55034f1ab5d47bfd212deb5bcca76ed15adbf2e + docs/models/createagenttaskpermissions.md: + id: 0ae5d67fff19 + last_write_checksum: sha1:be327514ffaf0e56dee0cc5f1c3017b10fffee13 + pristine_git_object: dcbf8575ebfb3666417be16dd624d91df869e46a + docs/models/createagenttaskrequestbody.md: + id: b170671696f7 + last_write_checksum: sha1:0bd9d4c9aed9c8e7b7b2415759d536282407c398 + pristine_git_object: 191622ff1ee4fd991aefa4faaf6d3ff84e8b0132 docs/models/createallowlistidentifierrequestbody.md: id: ba37868538e1 last_write_checksum: sha1:796a1f4e1cfdbae38f761ca16164057cdaeb8e64 @@ -362,8 +458,8 @@ trackedFiles: pristine_git_object: 1944c470e2449b604917d7dd5cab50475b09cd10 docs/models/createapikeyobject.md: id: 56db7d489052 - last_write_checksum: sha1:c81c3330ea6fe79463204b081760d9907da70035 - pristine_git_object: ddea3ecca4b940d2feea3ffe3b2b5cde795ada4e + last_write_checksum: sha1:3db2a6c5fe1eb8a0a94f952922135f5f2013edfd + pristine_git_object: 8072fb2d394629446a12b2cb9b54a54600a59d9a docs/models/createapikeyrequestbody.md: id: acfe49a8eba8 last_write_checksum: sha1:fc8987af84d0d0fddac4b60e4c3e32b27f7884d8 @@ -386,8 +482,8 @@ trackedFiles: pristine_git_object: bda10d0ddf18bbaa301138f5d451de3ce4f5692c docs/models/createbulkinvitationstemplateslug.md: id: f89462667936 - last_write_checksum: sha1:bf214b9617e2b816f5ea07fc446664bd237e21ea - pristine_git_object: 41580c50b14b3861282a626168d216d335742a89 + last_write_checksum: sha1:eb4a6f3553bd7024dc83ea799c4e50396d980f53 + pristine_git_object: 54d4caa71c08b35ea7926f85bd4641c786f36325 docs/models/createbulkwaitlistentriesrequestbody.md: id: 61baae306317 last_write_checksum: sha1:cbc03a23c8622983a0a9f69784f6abc760269c0b @@ -426,12 +522,12 @@ trackedFiles: pristine_git_object: 9e793694bd0f72762fa2e1de31dd8ffd1c6d397a docs/models/createm2mtokenobject.md: id: fc12ab3ebab6 - last_write_checksum: sha1:a794155acc24d04828fbacaf4970e01577a410a2 - pristine_git_object: 5b97627cde4b50e7e776c1ff10510a49e76c61a8 + last_write_checksum: sha1:bbf648ce84c68a9260abb3429931487c52eed719 + pristine_git_object: e6180fde784fb4d28c631ae60efbf65955e11a04 docs/models/createm2mtokenrequestbody.md: id: 26c1946a09a2 - last_write_checksum: sha1:a113d2f336710b909d49707d75d8bc4984dd0e9c - pristine_git_object: 6fbf1e694cb7ba8648a92869c863883cee0f2685 + last_write_checksum: sha1:f66755c7556725f2285b0efa8f0b1a41f2c5f5a4 + pristine_git_object: d2c2523caffba803f09958ce4f70f1aa920115e2 docs/models/createm2mtokenresponsebody.md: id: 6db128c5d0b2 last_write_checksum: sha1:a005c5649a7fa3f6ab54eeb007f0cf14cb10ee0a @@ -510,8 +606,8 @@ trackedFiles: pristine_git_object: c8dff7c251684fc9a2390aa508e3889c4d8f16cb docs/models/createrolesettype.md: id: 498d77738048 - last_write_checksum: sha1:26d8a0b7d37ea008dbeaaf1df46d16167cf7e437 - pristine_git_object: 7b54ed42926251659f6e5128745b64e4680a31d2 + last_write_checksum: sha1:f642432db935eb20d7cb3502c23e96aa2005ceba + pristine_git_object: bfadde58237b28af334ee71d895a27a7fb38cf2a docs/models/createsamlconnectionrequestbody.md: id: 758091a52cf1 last_write_checksum: sha1:fbcda102b082d789377bf4dd76464b2ce15cafd2 @@ -526,8 +622,8 @@ trackedFiles: pristine_git_object: fa4228bf2aa3e1a37f4e0f475b8505a12267ee69 docs/models/createsessiontokenfromtemplateobject.md: id: 13d07e68cb5e - last_write_checksum: sha1:19ab2555c34b6955dc93d0a78f619bb0b0d0bd5c - pristine_git_object: 6563205f8714128391146fcc69a6e6b6634bbffc + last_write_checksum: sha1:5c9d24873aaa68abc34b78fa015ad889e24aa17c + pristine_git_object: 0e8ff12d368216d40985493a9782e0845cda0a5a docs/models/createsessiontokenfromtemplaterequest.md: id: 0c64d18c66ba last_write_checksum: sha1:0e19224179558ceb42819828a7d81aeac3d537de @@ -542,8 +638,8 @@ trackedFiles: pristine_git_object: 62658b3e43e844da7d223a8bde1d89e80ab1c270 docs/models/createsessiontokenobject.md: id: d5c996e62211 - last_write_checksum: sha1:f3dd98d535300d47aae1161ad91fff5a13125098 - pristine_git_object: 67d8fcf663375c9bcdd5bb0fdec5c7f7e9d4ed55 + last_write_checksum: sha1:e6e3178708caab6196b460b4885ee5a7598c0771 + pristine_git_object: 31df2dc26cb8dc2602de1f95ea218cd1ff3e5420 docs/models/createsessiontokenrequest.md: id: 49f5944ce863 last_write_checksum: sha1:b538ba97937d5aedee3fb57778fc015ef18cb9c3 @@ -576,6 +672,10 @@ trackedFiles: id: c1a47bcd81f9 last_write_checksum: sha1:d0ffed761f218c87ddc174575570d24025efd7bd pristine_git_object: 862e791867a1492d3bad5e04146e456e4d344a4a + docs/models/credits.md: + id: 5a24a26e67da + last_write_checksum: sha1:cb9e47011f3f52a22c02fdb2c5cd09cacc4bf329 + pristine_git_object: 2462c6f9b079d5f1d4d8f340e2418fccff59a20d docs/models/data.md: id: 9a31987caf78 last_write_checksum: sha1:b1fda835a4dde5725d68615b0cf7eedfe06bab9f @@ -606,8 +706,8 @@ trackedFiles: pristine_git_object: 7c1a1346e59c81256060640488785fb424228d95 docs/models/deleteapikeyobject.md: id: 1ae5cb4ca457 - last_write_checksum: sha1:c69a276f42e22cfccca2d3d74ad6bbb585375149 - pristine_git_object: b0da67104d7a1873d198bb536b0e707d8c4801d3 + last_write_checksum: sha1:e8b66649e90b19be0f84ddc1b88b7a70eda9dc59 + pristine_git_object: 4913eebad1d29f5f52a4ae9b6103182cb2a20bc8 docs/models/deleteapikeyrequest.md: id: 5895e839f659 last_write_checksum: sha1:d34947b68774929d18104b88af129128c799ffb9 @@ -730,44 +830,44 @@ trackedFiles: pristine_git_object: 98771b1589f59490bf1625a4f7c8f6bf2d005759 docs/models/domainobject.md: id: ad7e42f05d05 - last_write_checksum: sha1:4e19538c3733a40b8e1e421c050968c427425a96 - pristine_git_object: 893b03e3ce607407289de1ff1d5a9a67caed5844 + last_write_checksum: sha1:4c360a2d498f3c36ef31a00263598150d8b2518b + pristine_git_object: c5fe0d03503f8ae7636aa47150235aa69491a464 docs/models/domains.md: id: caf2a1e74e43 last_write_checksum: sha1:03cf058c68f29433d5d5e1db2194378eadcf74ec pristine_git_object: a2e8ab21f60f15c072ea739295d82bced8226ec0 docs/models/domainsenrollmentmodes.md: id: 4e588929b81e - last_write_checksum: sha1:b92a0a1f722103ea955842c5259b3152c7e30ac9 - pristine_git_object: 5af92ef44b096dc626886c5ef9b0ffa2071a01ea + last_write_checksum: sha1:4dddba1682cdd51711acee1a6fb1971167bdda45 + pristine_git_object: adb540962feaa454e4304b49433e82d8be70d9cb docs/models/effectivemode.md: id: 7e6572459bba - last_write_checksum: sha1:daf6949f169f09cb39e57633c41db3c8cbaca86a - pristine_git_object: 2bca7a100e6066dd2c62c2513eaa8478fa86057c + last_write_checksum: sha1:8717e6b2fb6431fe18032829cb019de63655a676 + pristine_git_object: 11d39aa3f42618f8b2dfafffcdcf36bbcd1a28f8 docs/models/emailaddress.md: id: d59acccbf5a1 last_write_checksum: sha1:bfd8b6f17c1441c50b6a5dea3e7cf4933740518c pristine_git_object: 71688d9ed3993484978108b5604dcbaf8e5c3f78 docs/models/emailaddressobject.md: id: 3ebdbac368a5 - last_write_checksum: sha1:58654bb3eae0271b3816b0ba20289cf40585bd76 - pristine_git_object: d04e242e024ff6fa73283f3c7bb7a991ebe4d7c4 + last_write_checksum: sha1:80d2f422909747bb0af1e0ec943446d754e9178f + pristine_git_object: e0368673596b11e02afbe228d704c483b392b3f8 docs/models/emaillink.md: id: d86084f2f93a last_write_checksum: sha1:2826a27265f82ce0dec0ba9b87a54bb29df847b6 pristine_git_object: 8b480db4fa55419c77ae61fa905dc91152c0d18b docs/models/enrollmentmode.md: id: 4fc21918c24b - last_write_checksum: sha1:3d37b8fc769ab71479386894aab26e25b0e5a612 - pristine_git_object: 6888eb230d4bfd68648c75b3a89bd7d13801f02a + last_write_checksum: sha1:f50ea90c3c8c03a882c18b82a8e10ac52c9e5a47 + pristine_git_object: 91902752727ab915de72cc96f76bb065bc82bf87 docs/models/enterpriseaccount.md: id: 1021de4770be last_write_checksum: sha1:5c2f4042b77c9909ed644eecaf72d2a19e381d51 pristine_git_object: 20628b6b6453ecd639f649a4760241e26edd6b50 docs/models/enterpriseaccountobject.md: id: ab19404abda7 - last_write_checksum: sha1:feb513d4b29cd47cc377a13b4903095eef5ba08b - pristine_git_object: af4241d3e3c5fddf13046610d1a8a50f1c0554ff + last_write_checksum: sha1:35abf761f32a3b3260febfab769f466610ca1660 + pristine_git_object: d3f2c23ceaafc5d9eb2f63cd3d8d3c74479b7896 docs/models/enterpriseaccountverification.md: id: 3e5bcbd843ef last_write_checksum: sha1:565f5b3ccad8fb2e8fa810b2ac2e8c3d83b3923f @@ -822,8 +922,8 @@ trackedFiles: pristine_git_object: 6c4537bacd8f7e2277afe1a909d7bc50e6132606 docs/models/externalaccountwithverificationobject.md: id: 35e222a47282 - last_write_checksum: sha1:1a8c2bfc4aed4b4fd34baae5e23a1143fc33bd37 - pristine_git_object: 6c3c2d4c3dde2332d49029d120aa363df41c3cc4 + last_write_checksum: sha1:dedf8f719a5dd56f87272548576ebf3bf95f6f4c + pristine_git_object: b5861d28103b3f948e7a8a0b0b5550b9377e9257 docs/models/externalaccountwithverificationverification.md: id: 815dc234ae61 last_write_checksum: sha1:7100a7faf240c7d9696972b2d4d5908a894a8141 @@ -834,16 +934,16 @@ trackedFiles: pristine_git_object: 04aec53b819781ce7c6b55aa5887e89837c641e5 docs/models/featureresponseobject.md: id: c79886fd72f5 - last_write_checksum: sha1:29ae8240e0f00b32420a4fb4ef6b741a44f758c7 - pristine_git_object: 6b2e313c828f4b913df40d359def4acd79b00498 + last_write_checksum: sha1:28a9e121adc2c77565d74e2962449ac67e48afcf + pristine_git_object: a6529cbe75e8ca789f363df60c6626d66fbc2209 docs/models/file.md: id: 4ad31355bd1c last_write_checksum: sha1:ade4d3c908c664a07a3c333cc24bc1bfb43ab88b pristine_git_object: 37cc418f9e5189c18f312c42060fd702e2963765 docs/models/format_.md: id: a17c22228eda - last_write_checksum: sha1:4ac7e14e9a9632988fcd41c922447865b688cf3a - pristine_git_object: d424ad00da4a5cd4527ffd1abc7429c5743385cc + last_write_checksum: sha1:288a9da7611daaeb670789dfe06d96abf37e283d + pristine_git_object: 0c89d9982f7cacd7a37e663be7cec97a92fff3dc docs/models/fromoauth.md: id: 4ba160ebce83 last_write_checksum: sha1:6d74f42bc8d01ce202f1a0c8bc50367907e259fb @@ -866,8 +966,8 @@ trackedFiles: pristine_git_object: 3328c9c8ed1816f44db5e9615502f1a0053e67ef docs/models/getapikeyobject.md: id: 93aff170d3cf - last_write_checksum: sha1:14ad0ff1f9901171b3743a1b6f6469b22f4e2380 - pristine_git_object: 789c9efd010fa4956db39a3de0abe3cf7d7a1f40 + last_write_checksum: sha1:3a1b119942dab56b3da8e60b958425aca7e5861b + pristine_git_object: e65ec6e05ae5b13b737170f29e9502a98a570be1 docs/models/getapikeyrequest.md: id: eb72748c0fc7 last_write_checksum: sha1:d6c2949cd9ae0f33a7402f81f14bbabb02e50ac9 @@ -918,8 +1018,8 @@ trackedFiles: pristine_git_object: 52718fccaf6a7401936bd189aa27deb895246218 docs/models/getapikeysobject.md: id: 3146c9b1e9dc - last_write_checksum: sha1:ff366e2afa9a2002c0072b8bfb7beb29d616e008 - pristine_git_object: c794eba22d58223977c4612289100f82415d1f8f + last_write_checksum: sha1:c3ae2d42c8dc266b9d20fd9a0c9630aea307d093 + pristine_git_object: 731ad259b808c5969de75c6ce591acba46c48603 docs/models/getapikeysrequest.md: id: 1da61099f54f last_write_checksum: sha1:1cd1d5d5064417e28c6338f518b0531843c416f3 @@ -958,8 +1058,8 @@ trackedFiles: pristine_git_object: 6feb6241cbe7486204ec3788659cfcd7ad45c393 docs/models/getcommercesubscriptionitemlistqueryparamstatus.md: id: 6435725a38a1 - last_write_checksum: sha1:9edd5f12d6f2319b7ce5fef2ddb9af7e46a14934 - pristine_git_object: 409ddfa02db7b841f6ef5da56566552c66273c07 + last_write_checksum: sha1:122964f3c9444bb1df816c4b1dae29742fa3caf9 + pristine_git_object: 3eba9ece62f5c1c3104c6b31bdf05f71ddc7f0aa docs/models/getcommercesubscriptionitemlistrequest.md: id: 2e8d9dfc0bf7 last_write_checksum: sha1:51ab6504e0bb1d7d446b85dc59b5a3c26b1346d1 @@ -998,8 +1098,8 @@ trackedFiles: pristine_git_object: 4c988de11109e4788617f8a1ecdaf40e43248903 docs/models/getm2mtokensobject.md: id: 50aa986fbd28 - last_write_checksum: sha1:18d221b8ced428ee87d74126dc290d58c0a9e902 - pristine_git_object: 30dd93b3ab5bb221220b84feaf0f00ef18f43b67 + last_write_checksum: sha1:d87abdc5a7338d89c5db543185915b741ba56402 + pristine_git_object: 22790aeb5fbae086f68fcfa3eb3564a7364dd8ad docs/models/getm2mtokensrequest.md: id: 980b8eec10b9 last_write_checksum: sha1:c8c893fc1a7deb1b5d4f4edc923b81363a14509b @@ -1024,6 +1124,10 @@ trackedFiles: id: c15baca8b1e9 last_write_checksum: sha1:447370c2f97be857251b998ec48c4392cab18446 pristine_git_object: 781eb1b04d220f5bbed809a36644a3aa2138ab31 + docs/models/getorganizationbillingcreditbalancerequest.md: + id: f29bf58be64a + last_write_checksum: sha1:5af21a70136a6bbd414aebe53c9d96cc58dcd20d + pristine_git_object: b8d5f2dbc7cb9e5735afa5f1186b94bfa808b7e1 docs/models/getorganizationbillingsubscriptionrequest.md: id: 548d9e2fe3c7 last_write_checksum: sha1:307ea9a3d9a368cb5f33bc48b2c8083d6035e2bb @@ -1084,6 +1188,10 @@ trackedFiles: id: ef0a31879b1c last_write_checksum: sha1:85de112c1a768e746a0427156ff3ca05f7dddb6e pristine_git_object: f4dc62b239b7bab5d88be4e27b771a7a065a5490 + docs/models/getuserbillingcreditbalancerequest.md: + id: 69bd0030d843 + last_write_checksum: sha1:6f6a501fefb00af55af52647409e26a2df1cc47f + pristine_git_object: 39e61beb66d657915c17b123453ec792a4c119a6 docs/models/getuserbillingsubscriptionrequest.md: id: b8561c3f893a last_write_checksum: sha1:4aeb7ac7939afd2ee34774b4151ebe0564540dca @@ -1114,16 +1222,16 @@ trackedFiles: pristine_git_object: 62b6adcf2a9c60978b87a98d02655cea8de9be8b docs/models/identifiertype.md: id: 7a3d4b61b0bf - last_write_checksum: sha1:6f28473c5b6ee54cf81f7bf39f488dab124fb180 - pristine_git_object: 40d4d41eb1068143ae4e9663166923001a55bf36 + last_write_checksum: sha1:1504c033147822105a24bbe4867da96684f3b650 + pristine_git_object: 54d3d9cf27cd8d864748c0cc6cef6fe76edc20f8 docs/models/immediatecharge.md: id: b71d72c13442 last_write_checksum: sha1:9b26e55086b000acfbc4432557d07755f201017b pristine_git_object: 739574b0a55641acef19494736744255fd398095 docs/models/includeinvalid.md: id: f6ec0ead84d0 - last_write_checksum: sha1:7011db490d0a13c97b1b2e9bb0f00e8f924191b1 - pristine_git_object: 01f71cea24e13c2fe1a5df0c3dfce15fb3897425 + last_write_checksum: sha1:a452233e25d4441520125b315f6288e683cd96f2 + pristine_git_object: b48357a43d35d073dfa859481bec74cfcfc3aed1 docs/models/instance.md: id: 1686b90f785a last_write_checksum: sha1:ae69fdb643e45126672972eb4f7bc69bb75e19d1 @@ -1134,56 +1242,56 @@ trackedFiles: pristine_git_object: 46835e14f360f332f3cf8de164b6368ed831ebca docs/models/instanceobject.md: id: 54350ac395c2 - last_write_checksum: sha1:b3c5bf60b926e052fa8caaa2bc547ea7ee003577 - pristine_git_object: 808ebf94a5f5ae6d97bdcc1d08b6e15bfd24eca9 + last_write_checksum: sha1:14c195f0fe7d7f3f5c2ee961c558c856470fc643 + pristine_git_object: 5c708611ccf3db97aa9d20ca3c92d4c35e80a147 docs/models/instanceprotect.md: id: e5c5b3f574c4 last_write_checksum: sha1:98a4caef29abea6f6f31dd9214b07289733279a7 pristine_git_object: d5cea66e29277b63f2e8548fdbdcda980c17baf3 docs/models/instanceprotectobject.md: id: 0e9e3abf5631 - last_write_checksum: sha1:5654b02c927b445d03e6866ae74dc646e9ddb726 - pristine_git_object: 78515e941bef058cec4257d2c0f048ca062124a4 + last_write_checksum: sha1:ca376d94fe13d5e8f96f240b689a3b7dd4eb6a8f + pristine_git_object: ee0b461f950784529c084e8cc6c80eb6f02a0b8c docs/models/instancerestrictions.md: id: 59c66ed7ef8f last_write_checksum: sha1:7d525c204e260b358d4115e24aa18ae43b88aa31 pristine_git_object: 73d46107dc5f0c3864ff4b7c505594c45570e6d9 docs/models/instancerestrictionsobject.md: id: 20017a126199 - last_write_checksum: sha1:83aa493966f57358e9ed16b74b86dfec24ec0f03 - pristine_git_object: 142f45a7c151931967c168c5ff1d7dad4ff2129a + last_write_checksum: sha1:d7c57f1e070ef478bfac0c4358bf39735c92ea45 + pristine_git_object: 5d0d0907ea08dcdc5f350a8fe76e4bb8fb430261 docs/models/instancesettings.md: id: 2760a8ce514e last_write_checksum: sha1:d8d96cf289aa8427993d242921c4cecb2f1dd90f pristine_git_object: 272bc9d6d852e7a81db8b2b5a6f09d09549371d3 docs/models/instancesettingsobject.md: id: 1e8b69151a9b - last_write_checksum: sha1:0d50d7741a03ed4423e2d41cf9a48ff8056709dc - pristine_git_object: 0b1bac614f27865e6868a15130cc39eb033c9f22 + last_write_checksum: sha1:2d53b6890659a3946c71323ccff7c3f74def8b25 + pristine_git_object: 927d0b263be469bf61ed59c398675ce1ac20abe9 docs/models/invitation.md: id: "080527846e04" last_write_checksum: sha1:058c5f60af988d1b9492959a80504bcbe6815f22 pristine_git_object: 227d026d2a2d6f564b45c8d29892e890918ebb3b docs/models/invitationobject.md: id: 56633a282bbb - last_write_checksum: sha1:1ca9dd9439c9a7baa1b7851e7f418465caea8068 - pristine_git_object: c70a8642e560671b12b8186277a128584db6025f + last_write_checksum: sha1:59e9c4b1496a94de5ef0c68a96109c30572f6350 + pristine_git_object: 521ac89e3c68f583da61268ed9afa692727592e3 docs/models/invitationrevoked.md: id: fbaba6b7040a last_write_checksum: sha1:eeb8cdf204ccbdd43794067486702652eec79d35 pristine_git_object: 7975a33f883ba2d54aceb2914da251cf816f1fcc docs/models/invitationrevokedobject.md: id: b556cbd62fab - last_write_checksum: sha1:dfbb99fa7d62753b73fb51e8cd86c64987449528 - pristine_git_object: 8e8675f34e4ed44ae794ca0a15f0aba43554a2a9 + last_write_checksum: sha1:f21c75ce3b3d23801dd1fce82035c7c3aa0d61f9 + pristine_git_object: bde48c3d38dd33553657923fef6facd1df27a4c8 docs/models/invitationrevokedstatus.md: id: de77c6d46e52 - last_write_checksum: sha1:bca207af6eaac1b8a3660cd96c4e995482fc3d6d - pristine_git_object: 36eda6ad59e40623b8f6a0b77a4f9d702a60a90d + last_write_checksum: sha1:1781f163dc69eb40c2ef9570e2fead6b023195b2 + pristine_git_object: 4517a280db32a181e4ad4614eac4c3290bfe7b46 docs/models/invitationstatus.md: id: a57238cdad09 - last_write_checksum: sha1:c91188d5dafa3899f77188f28258a1c7fbcf1ed1 - pristine_git_object: 9d487c02add65174e4007914532536b99adf3abf + last_write_checksum: sha1:b148bebc0a910a5cfa42f22a8fba1aeb202e3648 + pristine_git_object: 8d6f95e94c70e72072effbee41bc156a402a3595 docs/models/invitewaitlistentryrequest.md: id: 9bce4b50dfcf last_write_checksum: sha1:822f8a35995aec11e0ac1b5ed9997bf7035c7a27 @@ -1202,8 +1310,8 @@ trackedFiles: pristine_git_object: 0ce3c32f4e26f8522feceb5e9af3e08d5c131bfd docs/models/jwttemplateobject.md: id: b324729f4f6f - last_write_checksum: sha1:28a2e1bca905cf095eda0ee0bc12868d6405a367 - pristine_git_object: 707c0e14802acb0f7a145762c133a5727ef5dd84 + last_write_checksum: sha1:e4ed7e322eac1a5461ba71e9fdf232baebdd97ef + pristine_git_object: a65413c39ad1f0ec2f310581787894dcdb184662 docs/models/keys.md: id: e00b012cd503 last_write_checksum: sha1:8496d15569ad93fa932dca7474ac864b20114ccc @@ -1222,16 +1330,16 @@ trackedFiles: pristine_git_object: 68b60601782bf04cf4faf8bca4d89f1fb4fd180c docs/models/listinstanceorganizationinvitationsqueryparamstatus.md: id: 7106e0bc6066 - last_write_checksum: sha1:095de3f1977146c32a37a15bf90794ba72b7db26 - pristine_git_object: 8c478eb4e102ddb3e76817fe5b5092c674601f11 + last_write_checksum: sha1:7680d0d05ec1c860f4e128933812c714cc4d93d3 + pristine_git_object: ceddcad9195b8b0f0fdfeeac2dbd43a1f9bfa6f8 docs/models/listinstanceorganizationinvitationsrequest.md: id: 4ffc85afc692 last_write_checksum: sha1:874649679c73ae346e18d51898d499d9115ebfff pristine_git_object: d2076ba215e62e1f98cf97d01c4ea1d2d58034d6 docs/models/listinvitationsqueryparamstatus.md: id: 351e63389e8a - last_write_checksum: sha1:c2ecdfe9a51aa7332b3097fda751612553bd1b67 - pristine_git_object: 610b2d6d3959d1e3398ffd4c84568f480ed6dfb6 + last_write_checksum: sha1:ad3ce8a66f39a7c48383fad0dc7b267623e30dd1 + pristine_git_object: ac0b6053b54fb02c2f8c66903645de3d2016dbd6 docs/models/listinvitationsrequest.md: id: f109ea6530b0 last_write_checksum: sha1:693e21babb69c7b2ac90575137b01bda62bef3b1 @@ -1254,8 +1362,8 @@ trackedFiles: pristine_git_object: 6c5aa142924734292c911817aa20fe21ef694419 docs/models/listorganizationinvitationsqueryparamstatus.md: id: 5c6517fb97a5 - last_write_checksum: sha1:1d3d3da9ae601d2153ee15270a2f34b4337efb91 - pristine_git_object: f7d0225544441095520b932a04665da8afa1a8ae + last_write_checksum: sha1:83302351fac9d2c71746f85f78611c884dfcf975 + pristine_git_object: 218f7552ccdfccf9238b16068b403bdb4897075a docs/models/listorganizationinvitationsrequest.md: id: 8c00736b7fb0 last_write_checksum: sha1:c1ba15e5d172d8b4881806318266d8ee0bd50912 @@ -1294,8 +1402,8 @@ trackedFiles: pristine_git_object: 9911b32204754991cd1e4eb22a57c6c0af7e10a8 docs/models/listwaitlistentriesqueryparamstatus.md: id: 4510ca246392 - last_write_checksum: sha1:0d6a6adcf203af02f3b7c89238867e1392fd29d6 - pristine_git_object: 4400e1550cf4b6f95fd9cf3a5ff1639425c95114 + last_write_checksum: sha1:b78683e50533573078fb3367b8c4080f6cc9a608 + pristine_git_object: 6c0eac2f42e4c5b381a0660855e6975a51fd90f5 docs/models/listwaitlistentriesrequest.md: id: 153ace915e61 last_write_checksum: sha1:75cf33a0c57dfa8786d2af6e18775d140f489f76 @@ -1318,24 +1426,24 @@ trackedFiles: pristine_git_object: d59943be9d38679e1a4e75b3614642a4225e88c0 docs/models/machinecreatedobject.md: id: da177b8076d6 - last_write_checksum: sha1:3e6f0525162ecef1cf6152dad664d1939d22ff72 - pristine_git_object: ea11e95d2817729bb99760cb62685825d28a1c94 + last_write_checksum: sha1:2dae7e8ba04fbf6191219ac708841b1e49502a64 + pristine_git_object: ca89ce84d67945f6a0e1a82c8847ae04f0bc2c46 docs/models/machinedeleted.md: id: e1e608988000 last_write_checksum: sha1:cc3f47ac41ba9ccf652c2277cf66d269ead1ac7b pristine_git_object: b89e715273277e1cf3cbdc67ba952a4be2116117 docs/models/machinedeletedobject.md: id: d26e0667df31 - last_write_checksum: sha1:ee7ff38cde58d1578fdd2b8c7c6a1a23d4748c20 - pristine_git_object: ae27910aa5fb2b28371819f3ebbb1acba8eb7412 + last_write_checksum: sha1:5e2a06e47bf5da7dc6ca2edc30107fc84710d252 + pristine_git_object: 2012ca03e812e88744c379c193505d54a443732d docs/models/machinelist.md: id: ffd5518e50c0 last_write_checksum: sha1:468b7b1bfb418c3fd2e6857a963aa5fa1a74d555 pristine_git_object: 7274930b0284d01f45b76df078313f9813e7ea5a docs/models/machineobject.md: id: 336848c6b1fa - last_write_checksum: sha1:ee6677d64e8d9e3a4deb7f56d2da4639f08b151e - pristine_git_object: 5f26e764b4ea3b47b66e7141689a97b0b9afdf11 + last_write_checksum: sha1:bcffed5b6fac48b3add48888974ee18cdbc499c7 + pristine_git_object: 2f113fe6c9b676aa5f3b90af6f8c7d705e8f2306 docs/models/machinescope.md: id: 8174b7d70672 last_write_checksum: sha1:29bb71fbcf676ba415aeb9ae6aa0631fb0f6c1d4 @@ -1346,28 +1454,28 @@ trackedFiles: pristine_git_object: 0376c6f162bf4d6308958f1e44ee3767590d74f6 docs/models/machinescopedeletedobject.md: id: 45f401ee1f0e - last_write_checksum: sha1:f1478824cda079f3b21d87e022c8f16c4b22b734 - pristine_git_object: 59c4cea509b6df7bb546835b550ac61c56de5f6f + last_write_checksum: sha1:cb5f0a056fc7ba101c12211f06fb613a19440eac + pristine_git_object: 8bc5f0d67aea10586dae52654aa4929c4eee5803 docs/models/machinescopeobject.md: id: 17198de9fbb7 - last_write_checksum: sha1:86b8d25ba0aeecc346e8feb30d1dac150ded76ed - pristine_git_object: 1e04958abd1de486c1295b290131802542efbddb + last_write_checksum: sha1:ecfff2c95e7955a0e46b46bef7b8cdf3ad391cc4 + pristine_git_object: 73a55f124eda5343f592fd855a5b49a2d68cf103 docs/models/machinesecretkey.md: id: 41ad2ef54ba1 last_write_checksum: sha1:3559bf62c178aafcb239d07a6d171c576bb84138 pristine_git_object: ef717dcc50b736650d777a1fce2a5e90f8be4188 docs/models/machinesecretkeyobject.md: id: f7694ea70cb2 - last_write_checksum: sha1:defcac1f1498d4de548ae6400ee5ba6b00cf4fb2 - pristine_git_object: fb2e5caeb88b4cb7a75523e123324b323b242ab8 + last_write_checksum: sha1:2a32c2c2d2aedea914c2d92af27844d3ac856650 + pristine_git_object: c8de05973ec1b55911a75a64c4923a0ff505d6b5 docs/models/machinewithoutscopedmachines.md: id: 8e0deeb3b415 last_write_checksum: sha1:8736832261e1003a27a437f594bc9f8b90f22294 pristine_git_object: d5abc63a9741068aa5810631a486f3f319cfd901 docs/models/machinewithoutscopedmachinesobject.md: id: 5962eca22bd5 - last_write_checksum: sha1:ff17be078bd123a4a9600a021ef63c92e938ce47 - pristine_git_object: b3a5083e58275b32db8a8015cf2ab2cf674ea5a6 + last_write_checksum: sha1:92ca4989c317918548786dce66f8dfa8f7959bb8 + pristine_git_object: f61db25283e04579143230e8dff593bd6868c4b8 docs/models/mergeorganizationmetadatarequest.md: id: 6a0c8cc5108f last_write_checksum: sha1:26aaf54aef1cd67f90a0588754b5b7e872adecff @@ -1382,8 +1490,8 @@ trackedFiles: pristine_git_object: 93f98d6ad4d1504e6a3849971be592f31f4eea76 docs/models/nextaction.md: id: 7c8a867e5482 - last_write_checksum: sha1:03016dbdde29ceeba42317359f257090fffa1bff - pristine_git_object: 16ce049e0d36b215968188ef5e5b74175addbb04 + last_write_checksum: sha1:41e0a715b0ebaad962078ce65ebddb36687e740d + pristine_git_object: b66127782e71b1b165a768742c5519d85e9903c2 docs/models/nextinvoice.md: id: 61a145220d4d last_write_checksum: sha1:fb9ffc514a7aa5cbc61138e6bd9da331b89f70e4 @@ -1394,8 +1502,8 @@ trackedFiles: pristine_git_object: dc8bc54ed70568c03dc9a977fef8d286b788ba00 docs/models/nonce.md: id: 5c2e5d9b660d - last_write_checksum: sha1:0ea68a10ef2960e4699e35cfa331495a1ad79c95 - pristine_git_object: 29706b1125900cb6574e8c2781f7fb1eb3a4f6b3 + last_write_checksum: sha1:462775f95d84e297acba8decfe9acca633c0f72e + pristine_git_object: ed1fc26408051712a33a61adad4f6506cf2d9b70 docs/models/oauth.md: id: d9a583e878a7 last_write_checksum: sha1:84a9bd7a7a7b1d6649d89a081c72ba219434d227 @@ -1406,32 +1514,44 @@ trackedFiles: pristine_git_object: b5cfd92156b93f9734a1a427a4c31a78176c84e6 docs/models/oauthaccesstokenobject.md: id: 713699c4af40 - last_write_checksum: sha1:fc72b8bcf7fbef3453960703dff9b25ae80a11af - pristine_git_object: 4ad2d007be3d994a3027055e34c28ab3e4549599 + last_write_checksum: sha1:448cbbbcc82bb8cf99056700e29175c5d9fbc327 + pristine_git_object: d2e8f90a4613d273d778bfea4d11d209d4e6ae13 docs/models/oauthapplication.md: id: d86d5655dcc3 last_write_checksum: sha1:9dcba33107d4ccf25ff57ff5e67989e4d67b2ba5 pristine_git_object: 1cbd0cab8b9d7db16f7205cf5050bfc8d96a1e15 docs/models/oauthapplicationobject.md: id: ece18c7d6b54 - last_write_checksum: sha1:c1b00685303488b6a98647492e5d684232eb1e33 - pristine_git_object: a24dc9679ba020bcb56be8526d5e56b930a3500f + last_write_checksum: sha1:873dfa9f8e09f7cc7a1836777826619637feda61 + pristine_git_object: f20ece2983146918d1596d7b9f40c3d5be239638 docs/models/oauthapplications.md: id: 5d0b507d4ef3 last_write_checksum: sha1:ff1ebb49bb87451aed9d822aca73a0cc2ad3d42c pristine_git_object: 59da0c4647209a3f9972c680305848ed8cfe0efe + docs/models/oauthapplicationsettings.md: + id: 3b1146edc6ce + last_write_checksum: sha1:82d475d382c04c231d4305cdb3f7af41e8d5538a + pristine_git_object: 13f4b778af8c54f4a8a6ebb95ebe83e93d553e90 + docs/models/oauthapplicationsettingsobject.md: + id: c5770eda5f50 + last_write_checksum: sha1:881988cec4152828cc2cf49463133e8799b84dc5 + pristine_git_object: f26add8e2ee06e38ee277dc23f626772e9ec0010 docs/models/oauthapplicationwithsecret.md: id: 0149fac6c198 last_write_checksum: sha1:18c9c368cbe0a7031935c4c148ae309b5ff42f15 pristine_git_object: 322320090a65dff123ac60ef821aaf62e4f94936 docs/models/oauthapplicationwithsecretobject.md: id: d96235915152 - last_write_checksum: sha1:66bd864b800514a49ac7385b8d21788de9533c8d - pristine_git_object: f30575265c9bf0d8a6a05d1f057c8b89179a130b + last_write_checksum: sha1:b16a835ef5545aaac46ee23af2a4d8dd2dcf1b68 + pristine_git_object: 36dc1daa06095402ca8034542d2f2193c868a729 docs/models/object.md: id: 7ffe67d0b83f - last_write_checksum: sha1:d140526c45de9266845f0e7aa33b783902e553e2 - pristine_git_object: ec43ade1b123350de053aaa1a9c1ec9334864d83 + last_write_checksum: sha1:4548f466e0d55207132b238be766e05d40e448a3 + pristine_git_object: bef0753ed87a3acd5835faa52b710f2bde3c0014 + docs/models/onbehalfof.md: + id: 27a8fd6c07d1 + last_write_checksum: sha1:1012d439a3b90f45fcba4c9a142a4227dd68b24f + pristine_git_object: 409a83fe7e2b8a2fb2c42aec3120f31610830488 docs/models/one.md: id: 69a5df93c480 last_write_checksum: sha1:aaaa8fb610c2a91100f530ffb2ff6b5700c3b7c6 @@ -1446,16 +1566,16 @@ trackedFiles: pristine_git_object: 5bd40e41956df9995fe0d9c03cc1ddf13eb808e5 docs/models/organizationdomainobject.md: id: 1f74997acdd6 - last_write_checksum: sha1:999a72035e9238d08f1de30e2db73ec31b3291a0 - pristine_git_object: 60cf426310465e310c2eaee9df0b43b07330023a + last_write_checksum: sha1:1dbee1f81d501e690a68993f76320b9163a43e74 + pristine_git_object: 956eda3dedb5af994f33fb073608d7a865e97715 docs/models/organizationdomains.md: id: ff63321cf681 last_write_checksum: sha1:dce26cd5cad6f56b279c485c2f2e2c05b7cf2e82 pristine_git_object: c57ef160e58f49d200d9eb3d69eef1963a7f3da1 docs/models/organizationdomainstatus.md: id: 1150bd7c8eee - last_write_checksum: sha1:9049dc73519121f309bb6306889cce809315151a - pristine_git_object: 1b2a5f0c45ed789cdd8ae817e9fa44459f3e0b53 + last_write_checksum: sha1:f1da9e7a03cb8cb938d79af24af773bf0cff673d + pristine_git_object: c4f60c55f9b11a562f4510f69149f3e0dd7b1929 docs/models/organizationdomainverification.md: id: 61b1104148a2 last_write_checksum: sha1:0ccf34ab1b8f595fbb0735f3a38e82e27b589b91 @@ -1466,8 +1586,8 @@ trackedFiles: pristine_git_object: aeb16a2496f2d2d648fb65663dd89060e2fcaa1c docs/models/organizationinvitationobject.md: id: 2986c3caaf1a - last_write_checksum: sha1:bebcff84112998e1f7d775976eefac0baf2e52ca - pristine_git_object: be5a971038c69b0c5b5f5520d4559bd317f2a57b + last_write_checksum: sha1:ac13906a1e470ece0eb77961426b1d1f1b651794 + pristine_git_object: 00a4d681c044c6b8add15b45e39c7dc80567a207 docs/models/organizationinvitationpublicorganizationdata.md: id: bc513067be82 last_write_checksum: sha1:0618eb0b1a566d87ebef1af0dc9de942f1bc5bd7 @@ -1490,24 +1610,24 @@ trackedFiles: pristine_git_object: 3d7836c2bf89623c2edc8cb30529e103f72cd910 docs/models/organizationinvitationwithpublicorganizationdataobject.md: id: 96a4d66ce0af - last_write_checksum: sha1:9d65f81eda7e8d6deee80f091b5a160586937e20 - pristine_git_object: f801fbdeba2b2fe175ab6817d7627b5fe6b8e1ca + last_write_checksum: sha1:4ad30b242367d343ee44f4014a833d7f85e6dfe0 + pristine_git_object: f58d621f83983943a672e7731f132eecd1641e43 docs/models/organizationmembership.md: id: 83d47b3b2c72 last_write_checksum: sha1:d0833b09dd5bd8348ee941ec41ae43439136685b pristine_git_object: 64ba977aba0a165c43854bc72ed85cbc80ac63eb docs/models/organizationmembershipobject.md: id: da6f4a07df9f - last_write_checksum: sha1:df208d74a6b8ad002f03cdc327380b9114ebcf39 - pristine_git_object: b06b6f2ce2ca62876f38860dea6d07aeebaf5d54 + last_write_checksum: sha1:398cb28d6b249da1ccabe41fe2f8bb885c14d26e + pristine_git_object: b875c052400cc3ee3f9fe82a0c8ff992687ef2a5 docs/models/organizationmembershiporganization.md: id: 15d8223f4731 last_write_checksum: sha1:bc444ee7d509af1b5a2a2bb3db95c4aa03ae60a1 pristine_git_object: 3b8b8c5e047d4f2a9a3f1fa8070478838a0d9eb8 docs/models/organizationmembershiporganizationobject.md: id: 4f2629cb67a0 - last_write_checksum: sha1:3df72692012ed2b59dff92eb716ea5e55f62f1d3 - pristine_git_object: aa6222b04bd7b92c363821171a726f445d5469a3 + last_write_checksum: sha1:20b3570e30151da1f75075f6648ee90d87f741e2 + pristine_git_object: b111087f280c227c1629f4858b5b5f67fe57fae5 docs/models/organizationmembershippublicuserdata.md: id: 349f4db08624 last_write_checksum: sha1:e57fea4a70b2e42886270ee7560bf1d2494ff628 @@ -1518,8 +1638,8 @@ trackedFiles: pristine_git_object: 132d9754365d2ac4e3f142729900398bc8f21f53 docs/models/organizationobject.md: id: 9937af939465 - last_write_checksum: sha1:1ab039688008b81c4c1364be5ab70997e675dc31 - pristine_git_object: 30e26e25eb1d8955cd7f3a535afb634f8d2acde8 + last_write_checksum: sha1:549fefc02b03a017fd0225313c93d5fc134c8f07 + pristine_git_object: 3f57c88f7cbc4140052419b8ed402076003d0ddb docs/models/organizations.md: id: 4d0d190c7ab8 last_write_checksum: sha1:a76f505f0408c94f309b453d9117804de2160d01 @@ -1530,16 +1650,16 @@ trackedFiles: pristine_git_object: 9c6dd4aa011a6233a52e0c8e8d033abf2b2dfd47 docs/models/organizationsettingsobject.md: id: 0b9940c511cb - last_write_checksum: sha1:cef113dc0d63b704430227f50ad2d484cd3b369b - pristine_git_object: 023bd0877f2947ca493b184a665d14537ceea4ee + last_write_checksum: sha1:6e9ff91be2f1e118c26dc00854ef77d26200cc9e + pristine_git_object: 1b8d964bf1a08bf08b425ad096b93cfd154a2224 docs/models/organizationwithlogo.md: id: 14d59dc62841 last_write_checksum: sha1:ed129aa3cf7f260e780c320d7251d0ea9402b9dc pristine_git_object: c84c2a661fff7f724267d88df67b1d1f3cc81245 docs/models/organizationwithlogoobject.md: id: 227d023013e5 - last_write_checksum: sha1:2c1ad39e34d91051272a1e66c42d6e61655e90ec - pristine_git_object: cdb1d2e7e666c40bb446f084eec6db54e94d7fb7 + last_write_checksum: sha1:cf0fa740d570b801c319d31352072cc848dee985 + pristine_git_object: 0b589c1e7c935eb34d2fe75d75d73bceb7a7e2c6 docs/models/otp.md: id: 9536feda7e2d last_write_checksum: sha1:88723e04ba091ab9959a2389c4aaa83a7205d7dc @@ -1570,16 +1690,16 @@ trackedFiles: pristine_git_object: f6e37678cf76703aa5325d899e29c8ecf88ec019 docs/models/passkeyobject.md: id: 1ced675bc78c - last_write_checksum: sha1:0a0817c2cf177bd0b8e141f8703f499de4909e0d - pristine_git_object: ea55ec21f1d5db05d41dcb0ae3559e1e9df44a30 + last_write_checksum: sha1:7567613e9bde499b9b46082511b9ba9d76f7612e + pristine_git_object: 328871e138d7c244e8ef335f9ae0a48ff4b3203d docs/models/passkeyverification.md: id: b0152a979a04 last_write_checksum: sha1:7bd1cfb0384c16c59db9a493dd2d00603a42cd88 pristine_git_object: 515f977d71c4329a4d147534eb80377ff28f6086 docs/models/pathparamtemplatetype.md: id: fb953bb6840a - last_write_checksum: sha1:11717a850c684843590d98c5498c8906ba50bf73 - pristine_git_object: 2646b2f93be02e7ca43c9e871f9cd68d9792c701 + last_write_checksum: sha1:2b31571718f78c572235837f0da242582864ef2a + pristine_git_object: 90fe89fc8b07fe54d110500e98e5acb278058bc2 docs/models/payee.md: id: 1b1e8012fded last_write_checksum: sha1:c7d709262738d791a2099e9c98df81ae7cef1a27 @@ -1590,28 +1710,28 @@ trackedFiles: pristine_git_object: ca71b47e1b6f6c67d62930b359892b58b00776d9 docs/models/payertype.md: id: f4b8426c46a9 - last_write_checksum: sha1:a2d3dcc819cb2c19191c18d6124a8d2d5d115e4f - pristine_git_object: 69c1247b1d81ac121acf8de9b175059f9ec6bf21 + last_write_checksum: sha1:1d0f37163feffea74a57d9b6ddcef83cd439a4ea + pristine_git_object: 51cb168c8b79643017b4c3e940337984cc7dcc84 docs/models/paymentmethod.md: id: 17c910bca1fb - last_write_checksum: sha1:0fbf330300caa14345b5ded0c78f1898d17de949 - pristine_git_object: da0b507b3b501c58987bf76b758b03ad3912f2af + last_write_checksum: sha1:aa1a307035c941727af512c80db1ed64a3065afa + pristine_git_object: 54085679c0e3be953d237a655d6b0b8d813335ea docs/models/paymentsource.md: id: da1965c286df last_write_checksum: sha1:c62f82101243ce2b420adae472e895483cb03d16 pristine_git_object: a829e24a38cab5b4c0d35d1033bf43d38a7aa55e docs/models/paymenttype.md: id: 514206741b5c - last_write_checksum: sha1:0b1ecfb27c5362701d510c378d99235f5efed252 - pristine_git_object: 809cad06caf8d704a589d9d0592aabc63b1f7ecf + last_write_checksum: sha1:c5f2b848cf5b2790ca7ba74006d239813d659f03 + pristine_git_object: 3a42efd28c7c6ca0d529fd4a0088230c740c22fe docs/models/permission.md: id: 2e72d664ef50 last_write_checksum: sha1:6c4d07ecca94012cd5a37fa84456df4e98c40246 pristine_git_object: 72361f16ce265151d0535505879209042b2f1c59 docs/models/permissionobject.md: id: 10b3eaaa376a - last_write_checksum: sha1:2b95219942a54e147338f3e795d4c6f4a38f25a4 - pristine_git_object: 13f12200f8fcda03d191721a983b0180d1dd67d9 + last_write_checksum: sha1:cdfee36de4bd1bc61047fa99b7ab166513b00faa + pristine_git_object: 481a07baa083cdc6294552eaeca7703bd03125bb docs/models/permissions.md: id: 9f5fb12f1ed7 last_write_checksum: sha1:7c55983e1d8a9b390be9a895ac89005dd493df36 @@ -1622,20 +1742,20 @@ trackedFiles: pristine_git_object: 36638845f5a02ccd60b6e8f2cdea3617b7e3063d docs/models/phonenumberobject.md: id: 62bd5755e1bf - last_write_checksum: sha1:34314e856a5d98662684c03369aab15b9e58fc26 - pristine_git_object: 18fc0c38570548b059f8c7ed94c02cbe9580f412 + last_write_checksum: sha1:b11fe644f53e051d940a540f89a4ab242d7d46c1 + pristine_git_object: 3435d90b9db6ff70da9cd8c7956beee839c39943 docs/models/phonenumberverification.md: id: 9fe58d184d6f last_write_checksum: sha1:122070f3cd0e59297ef4a307fe929f40928c2ecf pristine_git_object: 2bbc67deb98c9decedbe8bf5d94dd03a5e5d626a docs/models/plan.md: id: 900c4149ef4b - last_write_checksum: sha1:00cd2f389bb465bd0403ca6fd38b1b82856518c8 - pristine_git_object: b2e5b2723df51bfc081edeecccc5d7fee6c6b9cd + last_write_checksum: sha1:c836f8e27e9c088462703dea97953b0b067bc5e2 + pristine_git_object: c07c6b8cf8e423e734c02a5a1cee601552052f86 docs/models/planperiod.md: id: b942ce9be6fb - last_write_checksum: sha1:4aeda74d922fa4d17bcaf781223a4efa974da8d5 - pristine_git_object: 7f962d24ced1131c7a883572ff6ec0ab6ef86bba + last_write_checksum: sha1:3f7e04f74c3027d85a072096844a291dd781c00d + pristine_git_object: abca4ed5c139b128742c86e7b652bc6cd797c2e0 docs/models/previewtemplaterequest.md: id: be1b6bdf54b8 last_write_checksum: sha1:02df2547e5e251628be69ec65dd8b43b9283fdd6 @@ -1650,52 +1770,56 @@ trackedFiles: pristine_git_object: b930c48f83ab6aefe21477331b9c0d8ed13ac946 docs/models/previoussubscriptionitemstatus.md: id: f35706530fa4 - last_write_checksum: sha1:fc6024cd773d37ee771c5da38bdec0c94421f668 - pristine_git_object: 86033b3078773252a22d647a39e83945511d1429 + last_write_checksum: sha1:ba1708759da6bb7ee5ade3032a271a2c35d6ece0 + pristine_git_object: 4f84feb1fef8c0de6315f1d9b5fa1eb41830efd7 docs/models/pricetransitionrequest.md: id: be99eaddf6b2 last_write_checksum: sha1:38db0d54f9fea918c40f2f0534844ebdb340718e pristine_git_object: 0261adefb3faaf916fa95ebe68950978eca137c8 + docs/models/proration.md: + id: ac1d089c0fd1 + last_write_checksum: sha1:69548e69cc859dfe9f83d371902ac1d049452956 + pristine_git_object: 0082460c57e232f1d1b5d4c8455ff12a6c2c1063 docs/models/protocol.md: id: 8174c2e84624 - last_write_checksum: sha1:cbef57e0caea0b19fd9e98680c18b23a16e5442b - pristine_git_object: caea7e3f5975991e0592c07ea0be94b29ca08c52 + last_write_checksum: sha1:705d2dea5a62a9b65ebf1b5031a17898ba12005a + pristine_git_object: aac70bef1afc39b4a08b095d4c88ab7abadfe34a docs/models/provider.md: id: cedb2a98f8e3 - last_write_checksum: sha1:4a46adbda0abf7336e240b62905870765198ef24 - pristine_git_object: 1bed0471fe055a72342e9c3cd0f39dee7ad592e4 + last_write_checksum: sha1:7a8b70f0ec1bb3759f33b3bf7bb13ddeeda6b054 + pristine_git_object: 1e9ad00b2e0f47953e370720edbfe9966bb28e27 docs/models/proxycheck.md: id: 97c1b1ebb08f last_write_checksum: sha1:da503cd8d00de44023d4965baf37ac7f12a5fc0a pristine_git_object: 88ba3cd8b9fa34a058686869934712a813409a25 docs/models/proxycheckobject.md: id: c93bcfff915e - last_write_checksum: sha1:4328d3c19fbe70255f73b14e3850e252f7e344ac - pristine_git_object: 8f072d3b90cffe7b24fafa659cacdc3e6f6c514f + last_write_checksum: sha1:c1bf330dccada63e1c54bb240d6c1c619b75e567 + pristine_git_object: 517f4ec8daabd4726ef7c4838da4786c0f9e41b9 docs/models/publicorganizationdata.md: id: 9d47d9f1ca50 last_write_checksum: sha1:3e397cfe2882d4c23212eb9d200daafd9db527d4 pristine_git_object: 2e113f48ea54618739c1040356deae926920e0ef docs/models/queryparamenrollmentmode.md: id: 3a43269f72ee - last_write_checksum: sha1:8baee5bd841b69eb7d88cff085a03baa988d6dbf - pristine_git_object: 57f06cd8f94e6ddd26c7487a861277598bdb0d3a + last_write_checksum: sha1:3bbe0a990e2d3d1538e9a5608b0a1c4afb075157 + pristine_git_object: a318c83a5a737b86f3f46eacb6dfc648ec83a2e8 docs/models/queryparampayertype.md: id: b2f1e150103d - last_write_checksum: sha1:5f77b86a17ecd192d40d3e73cfc282215aa41737 - pristine_git_object: b1d66d8bad1f7f8e2fe7bf77eb0ce7ad89688289 + last_write_checksum: sha1:6d0bd4a87f0a0c1442cc4b27e625797ef0878f8c + pristine_git_object: c3ba30068e33d67c006288cc9e0ee6241159cd8f docs/models/queryparamstatus.md: id: 15628120923d - last_write_checksum: sha1:fc6095ddd51ca11e98e4b5323f5aa678cb9eb3ce - pristine_git_object: 69b7e96ac91f248722d44dcf8d3d177df343a23d + last_write_checksum: sha1:f0fbc3a74aa9863d350a043c2451c35345541ee5 + pristine_git_object: e7a27179273d79e27d4808de8c5d88d76244fb39 docs/models/redirecturl.md: id: e73863be50d3 last_write_checksum: sha1:03efa4af02293262f7aa6074ba7b178fe5ec9de7 pristine_git_object: 770042c93be3a4e08f990a4ec521a5f1bc1a200f docs/models/redirecturlobject.md: id: df52f8a73bfd - last_write_checksum: sha1:1cefcc5d9710e7b9a5db7901f9ab125237fdb62b - pristine_git_object: 5007ef4dbad569b6464e2683ff987c4f254835c8 + last_write_checksum: sha1:af0c2a6f066d3a343499e12a2b7e879799bada5b + pristine_git_object: 27d149a2b5e4adbd45e63f7c44b92d1decfccad1 docs/models/refreshsessionrequest.md: id: 66d21afde847 last_write_checksum: sha1:c9dff55d54e03a6c2774e702624a1621070198c2 @@ -1746,8 +1870,8 @@ trackedFiles: pristine_git_object: 09b1f4341f6092bc3be424872c317572a6218914 docs/models/requestbodyprovider.md: id: a6d10d1c5fea - last_write_checksum: sha1:437e3f53104a244f43ad4d9a414007d4ec7ce62b - pristine_git_object: f2ff5f036d4089c13b2f830259367ec8a65b45eb + last_write_checksum: sha1:926efb0a0eefbaeb0c15181bac0b765987f214e2 + pristine_git_object: 3234d33e4266f012a79e70b35dffb3a39bc2c31d docs/models/responsebody1.md: id: f324bedb3b30 last_write_checksum: sha1:9f855325b981d255b27b85148e42a6aa8a08d414 @@ -1758,12 +1882,12 @@ trackedFiles: pristine_git_object: 0e1e82f418f690bfbf08c534815b1114e80ed740 docs/models/responsebodyobject.md: id: 023855ad59f6 - last_write_checksum: sha1:33002fbfcfcdcf188b99f4c2d1216d8b96c6b399 - pristine_git_object: 1144fc3b31862fb8712456bc234cc8bfab1fb29f + last_write_checksum: sha1:392dc591845c353dcabe2fcd4634e90eee6d61fc + pristine_git_object: eb9ffa4af24c091d10b97cdbb332f397f6ffd63d docs/models/reverttemplatepathparamtemplatetype.md: id: 1f3c9ef2fa1a - last_write_checksum: sha1:3827b6f83298655f4243d186fe14792e46cca704 - pristine_git_object: f93ca382ee132ab0f3524e573963a229bfd5dbdd + last_write_checksum: sha1:aefaa1d86f21c846fcf822e1ef493c1fb4f037bc + pristine_git_object: 37529e0fd20000c222d86251455b5df0d23ea624 docs/models/reverttemplaterequest.md: id: f405589e5de5 last_write_checksum: sha1:66bc7a10d5e5c92b99a03eebc74fc5cdb129a2f2 @@ -1772,6 +1896,10 @@ trackedFiles: id: 384dba7f1e42 last_write_checksum: sha1:bd6e1c60ff911ddb6b6b6b4df7a4d0655ab60be4 pristine_git_object: 397c28c2e320c33fcca06db0ff15d9d1898ce8b9 + docs/models/revokeagenttaskrequest.md: + id: a5e6271daeb6 + last_write_checksum: sha1:abdb53d257434449793dfa65a0c7aee667d0eba2 + pristine_git_object: 9ebff7f2021c124aef38103b25a933b5130d0187 docs/models/revokeapikeyapikeyserrors.md: id: 8e5e6be2055c last_write_checksum: sha1:faa4e99074ebd68fb7243578595ccd21805eeb20 @@ -1790,8 +1918,8 @@ trackedFiles: pristine_git_object: 3fb7186499c05504cdaa2db9ce3aed6170c73c0d docs/models/revokeapikeyobject.md: id: a363b0fff97e - last_write_checksum: sha1:d0dbed0eb72e807e59fdcfd782a19190f8d39973 - pristine_git_object: 14d79c39376415a7d33b8d4fd814427451a28e99 + last_write_checksum: sha1:f8b310a941c56cfebfd5bcc34ed74a0390b1b8dc + pristine_git_object: 2dfd8f1f43448bb82b8b164ef7cffb5da683069d docs/models/revokeapikeyrequest.md: id: 6a658ef18d02 last_write_checksum: sha1:24d1f2759d0f5201449a13edf1967a1be2b8778d @@ -1826,8 +1954,8 @@ trackedFiles: pristine_git_object: ee216785898862ecff6ecbb5814e49a4ac421f33 docs/models/revokem2mtokenobject.md: id: 28e2faa50cc1 - last_write_checksum: sha1:00b377a669444a7f5133df9e5215ed127d510aac - pristine_git_object: 9fdc2c8a326cc50f957f8c5b973aa6667c3a8316 + last_write_checksum: sha1:88d7caa6ae12268cfeb2f0a5667d30560783381a + pristine_git_object: 6837249028451fc1c3864e6e60bd207eda690c2f docs/models/revokem2mtokenrequest.md: id: a9f13be16c27 last_write_checksum: sha1:703c9299862032f4f8af954ad3936040ec2b0361 @@ -1862,8 +1990,8 @@ trackedFiles: pristine_git_object: 7227b475eee6377d9277924a1b698644ae175691 docs/models/roleobject.md: id: 513e53f05078 - last_write_checksum: sha1:330da04a889bf507b8c87f7a1c6bdd5bf150474e - pristine_git_object: a40d328607fd4f6964e074687128c4ddaae71a1d + last_write_checksum: sha1:461f287d821e6eb05956acd7d50890dc9da67b7f + pristine_git_object: c2b10a9c4a7ad6f0bd5b91bf8ffe5c5883b805a1 docs/models/roles.md: id: 2af79e204ed6 last_write_checksum: sha1:9416fe8208c489d7a119357782572bb4631132aa @@ -1874,32 +2002,32 @@ trackedFiles: pristine_git_object: c8acfcb35a65160b164b8c1f39954848fe4333c0 docs/models/rolesetcreatorroleobject.md: id: ec8d76701a65 - last_write_checksum: sha1:4fe67c79df3c750ac3bf0b147a23865d7d48bb6a - pristine_git_object: a108279a1a220c31faba90d9ab74b48d3c669d2f + last_write_checksum: sha1:725ebc1c4105af55727c945f40b12023b93a329d + pristine_git_object: 463e3b03cb840474c107c61c3f25966603a11594 docs/models/rolesetdefaultroleobject.md: id: 34cc3389b0e6 - last_write_checksum: sha1:97a601631afd57b3450b36c157e6d58422a2daf7 - pristine_git_object: 5df9b4c0d5a3819c0b867b10765b267d51b8d50e + last_write_checksum: sha1:adf53e305628b78ff753fa2f568cdc469b739482 + pristine_git_object: dcdc83bd8315d2f24fa13bb4aab628e21df3da78 docs/models/rolesetitem.md: id: 70777978b48e last_write_checksum: sha1:3677d371c2c201f44814d901f51f4a0555c733b9 pristine_git_object: bce1454b44f0448a88592ad1ff6987b39e558052 docs/models/rolesetitemobject.md: id: 4a4113366f05 - last_write_checksum: sha1:d4954e319e0bf792510f69f60b6f1a60f5b4e7c6 - pristine_git_object: f42ab724a159a1acc6647497e9604a71e43787b4 + last_write_checksum: sha1:bf290e9d32dff2748422183c0e2e4ee4b80dbf21 + pristine_git_object: 4d159af46231b5982704cbb22273c7330521d23c docs/models/rolesetmigration.md: id: 05596c781a55 last_write_checksum: sha1:927c0e8fe9a39713afad9b1d62bb36447cc609e9 pristine_git_object: 3a339c7c0aa6932c12043e9980a1cf2b74347d45 docs/models/rolesetobject.md: id: f5af4cdf097d - last_write_checksum: sha1:d519aa5892dea855a423415048e47ed734a7545f - pristine_git_object: 06fb7253828f5c7d31089afb8ad015320533b95d + last_write_checksum: sha1:5e0043bb3b516b26229b7db9d8af5567e89d9874 + pristine_git_object: a8f9cd47ab5a181f1e41c819560776a661f56a54 docs/models/rolesetrolesetmigrationobject.md: id: 00624a6b5e3a - last_write_checksum: sha1:9c1b1064394fb01d8c69e65a6d94037a1cc6c5bb - pristine_git_object: 7449a0b3557b379b1f8ec04f43d9ddff6663e082 + last_write_checksum: sha1:b89b006f5aa9c9e75a06417843b9c39b2d1d9f88 + pristine_git_object: 071ceb3bb20a2a4d7f51fef320ad980c361105a2 docs/models/rolesets.md: id: 6668f9469afb last_write_checksum: sha1:fc7130d1b99378aac027091e25501b41e29f20fa @@ -1926,8 +2054,8 @@ trackedFiles: pristine_git_object: 13f5fcb5021c11677a2354b73ead0bd7d15f0b9b docs/models/samlaccountobject.md: id: 0be7fc16b493 - last_write_checksum: sha1:7505e7aee73bf2d1947ff029c90eaacf65f5c5f0 - pristine_git_object: f993007983bf606f15b135d8d6d611229a3638a3 + last_write_checksum: sha1:00aeafa57350215822425038aa62eb9d7c06e4e5 + pristine_git_object: 984038bca2cc86dbd9b7ca6dcd2fd000a91a470e docs/models/samlaccountverification.md: id: 42ce8395252e last_write_checksum: sha1:d0c1327cd40a99edcc06b7eec7c58572456500e9 @@ -1962,8 +2090,8 @@ trackedFiles: pristine_git_object: 2893aa190f4bfac932e26b0b44de127f5e3d388e docs/models/schemascommerceplanobject.md: id: 67f9e9ddb730 - last_write_checksum: sha1:dc3a8c8de06c645fdf02fcd58f9f74ddd7adbb4d - pristine_git_object: 0a914fbbd3e43b2d0239d8de32b341984f32b93c + last_write_checksum: sha1:0c61cab1318bbb2c5913ce8d8afa4097b1b46ebb + pristine_git_object: bfa7d74b8f41544d6e484a33221979a96e256030 docs/models/schemascommercesubscriptionitem.md: id: 4bde94be475f last_write_checksum: sha1:62bc7fe5370bbb3fac0bfccc3219926ae0b51886 @@ -1990,56 +2118,60 @@ trackedFiles: pristine_git_object: 30dce0674ce57694bfc6417b7713984f09e7ec7b docs/models/schemascommercesubscriptionitemobject.md: id: 249163d3df53 - last_write_checksum: sha1:f45026534c0a00398bb386ae733c8af58b81d794 - pristine_git_object: 1ab632b650ebad0694df2392903371c19f26ab87 + last_write_checksum: sha1:6f53341b05a4a9c1cdbd6d03ed56df15d568c7ef + pristine_git_object: f2090836052bdfb3fe7471cd6138f38fad0b73ba docs/models/schemascommercesubscriptionitempayerobject.md: id: bf2c13f3c8e3 - last_write_checksum: sha1:73c352aa10a982f46ca924889a1c64b4c3abea6c - pristine_git_object: a5eb1eeb48dd6e81b7835676f5c3866bc4c563c7 + last_write_checksum: sha1:2e0d739c3826d987edfd29f9a4b59f83f7e87836 + pristine_git_object: 6ccf67f2b3bf625fb29101f09f9eb5d0913f0900 docs/models/schemascommercesubscriptionitempaymentsourceobject.md: id: e0f2c41910fe - last_write_checksum: sha1:8c9c6df4d9c018eaa193e0a9940c8094c794ac2e - pristine_git_object: d0c5d679b61a4b1e1730436bbe04cd2565ee379b + last_write_checksum: sha1:19b1e24dd9fbbe6366795304a0344646849b5a0e + pristine_git_object: 3ae7b15920a0d1450e18f5bbe5ee3e7aa39b4ab6 docs/models/schemascommercesubscriptionitempaymentsourcestatus.md: id: b59b51ffe807 - last_write_checksum: sha1:a6c5489e4b18b1e41648dd77e4f3960d7e625318 - pristine_git_object: 9b95c8cfc6216ba499edcd4f764d6c472774f447 + last_write_checksum: sha1:c9dc0e2376847e0fc3dbaedd70338332af53a522 + pristine_git_object: edf81824937c63791b9d323e26ed5750e3f19df1 docs/models/schemascommercesubscriptionitemplan.md: id: 4f2f2767d0fb last_write_checksum: sha1:8737a3ada42b8f4d5e80167167bc6f70e201d6f7 pristine_git_object: 608d099b10809c421540594cb09e0438716d13bd docs/models/schemascommercesubscriptionitemplanobject.md: id: e2f951a02cc6 - last_write_checksum: sha1:57f65e48e9866943f48e67c3857b502e1e3312ff - pristine_git_object: 90280e004ddef4f3a13d78c70236f9dd9a385f20 + last_write_checksum: sha1:5c5ed09983a02ccf7fc995c07cad09e565743f2f + pristine_git_object: c6e97c10c0a1901227dc9fb19d5a44f19d2c32d7 docs/models/schemascommercesubscriptionitemplanperiod.md: id: 527fdd684480 - last_write_checksum: sha1:09b5f25cbfde3f1eeeaad320b5e7f043e9e8a919 - pristine_git_object: 893979672b8e8fa2f53333f12fa6e6ca8b3accdf + last_write_checksum: sha1:7dfdaf34c0c9d548db0ab3572b4f8dfdd734ccef + pristine_git_object: 42b3ae81659d176ddfef002bcf47364315cf97a4 docs/models/schemascommercesubscriptionitemstatus.md: id: c18c19e2acff - last_write_checksum: sha1:6e12795a50efda8265a4a15c86a0644802a19eb1 - pristine_git_object: 0d6f606720613b4a1d4d470b75b5c2c9c5d3a01f + last_write_checksum: sha1:deab06500a2ada3f0203fd02b55cd2589fd9965c + pristine_git_object: 6e35d845dc738f87761d331bfc04c9ea7a914960 docs/models/schemasfeatureresponse.md: id: 768ca9ff3f0a last_write_checksum: sha1:e95bb432e5d50c388da88645d2a65fae23552b50 pristine_git_object: a23741af6f4344d58f9863597c594b00816c9685 docs/models/schemasfeatureresponseobject.md: id: 8e19b97c176a - last_write_checksum: sha1:14b82c12561362e47b847ed47b8dd93c6a65c49b - pristine_git_object: a8faeba544e3ca2f8aa51a2e5d0aaaa21dc73623 + last_write_checksum: sha1:edd2e43d81a856df1e5aeeb0ef3edab513e3b858 + pristine_git_object: 62eeef0012c7b9e0166df6e6b2949a57ebb5544c docs/models/schemassamlconnection.md: id: 0eef5982b944 last_write_checksum: sha1:be520e0db2e3e601a8a22326fba47db485203dc1 pristine_git_object: 444dfc02a076d34b182a404f2401cdf2da6e282d docs/models/schemassamlconnection2object.md: id: 231bc29d0733 - last_write_checksum: sha1:4298ac489e763a3551a8cea219340c8f1baa9bb3 - pristine_git_object: 4fb6f14e1dc03568aa755deec40f9bba27803970 + last_write_checksum: sha1:d7a430ba3fb9f1ed3845ecf567221320166a7f1c + pristine_git_object: 99f400d6615f0d3b208c99ec4893f19c96f1328a docs/models/schemassamlconnectionobject.md: id: 80e4ad75c4aa - last_write_checksum: sha1:5ac1bb443e402824a347712326be22a510018bdb - pristine_git_object: 2fa22f8a1ea8ab589da8a75f655d3caf08b3fd04 + last_write_checksum: sha1:1146c906050a9cb7218f2e32c589a1a9a1940549 + pristine_git_object: db655468b16553dc75fc71405d70232e2b00c3a0 + docs/models/seats.md: + id: 860cbd360306 + last_write_checksum: sha1:828d70db85675b1146294019dda11ea950542604 + pristine_git_object: 52fd226b5e981cb84f049120b9854342ccfc1846 docs/models/security.md: id: 452e4d4eb67a last_write_checksum: sha1:b92237f55b89698b718cee58634a51a5cdb29edb @@ -2054,8 +2186,8 @@ trackedFiles: pristine_git_object: 58e133c1b217ba3ea29a0c02a9c1915684b6949e docs/models/sessionobject.md: id: c5b18d7c4bd5 - last_write_checksum: sha1:5ad909eb1cb116c7250e2cc40ff4a29b5cb2796e - pristine_git_object: ff6d435bdf78df79c2a64676f77ee0f047e40a6e + last_write_checksum: sha1:22144ce39d8aa21368f5777317798278e47fd59b + pristine_git_object: dd2f6131ca43564c80ee231f75012671b3ef7258 docs/models/sessionrefresh.md: id: 5f552b272727 last_write_checksum: sha1:2c82322f77d146b9c3eb63cc42b8cd907081ecf3 @@ -2086,12 +2218,12 @@ trackedFiles: pristine_git_object: ed192fa3da4a37f1eaf058ef0657d77afe6b599f docs/models/signintokenobject.md: id: 9f6b3940ea70 - last_write_checksum: sha1:78bcebb9a38363340aa59ac239ef1779cd61f958 - pristine_git_object: 51c2643dc5655a77c3dfdb570c10942cbec8061a + last_write_checksum: sha1:00c261e8593de01305c5a785988cfc33bc9dfbcd + pristine_git_object: a1f85dfb7ca846be46a328912e8573becfa3f2b8 docs/models/signintokenstatus.md: id: 7af542f5f470 - last_write_checksum: sha1:bb77b7fced0839f8bdac9b49924ef853eacd696d - pristine_git_object: d381a77f4aacd7899d12b2b4f8c9422259b97dec + last_write_checksum: sha1:ca341261bb77885b16a4da55786400a987534ed1 + pristine_git_object: 7e1f9dd71fe02a838a21c0ac0094b6bf612199f1 docs/models/signup.md: id: 14e23a2a0b3b last_write_checksum: sha1:6cd88e3395d895f39df65cb48f4b9fe28417761b @@ -2102,12 +2234,12 @@ trackedFiles: pristine_git_object: 2594f2183a59a4d2a711d070460be4c375c8c8e6 docs/models/signupobject.md: id: 69d465f67a8a - last_write_checksum: sha1:ff360c18fab8439f843efa3d47c333b83e852639 - pristine_git_object: 15c23345e55b05b804f3a6c068bb24c82cb4fa0d + last_write_checksum: sha1:c9a1c1cd1e988fc6699843a5f549eb795c9295fc + pristine_git_object: 72457aede788b262b5a70687a589187f64bd7b3e docs/models/signupstatus.md: id: 4000d09598b6 - last_write_checksum: sha1:d0633522b265734e1b81625f1f281218b8351bd7 - pristine_git_object: 17a919bb54c1e8d39b175b11a6da0e34ad823e7b + last_write_checksum: sha1:6742ae220ca19507fe511388c51fb7208de1df8e + pristine_git_object: 2035a09f04aca0e3cac7d65f26f859e0ef9433fa docs/models/signupverification.md: id: e891c267ee80 last_write_checksum: sha1:838d75f7fc2e47429d5de7fdf2a069f262f91f43 @@ -2118,12 +2250,12 @@ trackedFiles: pristine_git_object: 9dd06fde3a234e51ec5d4a13ad3afd6dc54e484c docs/models/status.md: id: 959cd204aadf - last_write_checksum: sha1:272987280dd60f23b752e32949073289754a8f52 - pristine_git_object: 5411a4c4695c6047d036dc694c0d910364f57699 + last_write_checksum: sha1:ece7cf30b893ef72816b90181b8b8f9aed71d4ed + pristine_git_object: f2a4c7e8aa16b5e60a65de9f780b2a64e658565d docs/models/strategy.md: id: bfa025aea881 - last_write_checksum: sha1:8957a1af7e842b336dc80de8535a329297859523 - pristine_git_object: bba7efa9743d68512b5216229d10d60b0bc2b3f3 + last_write_checksum: sha1:fcc05fb7856d27aaa5b94ba37480a21a4633fa40 + pristine_git_object: 3e586a083e17ef7eda22d35bf957067776d52631 docs/models/subscriptionitem.md: id: 95155396faa5 last_write_checksum: sha1:6ad81758359f5b568827f57917a3f61ff200850f @@ -2138,32 +2270,32 @@ trackedFiles: pristine_git_object: 0601a8d091c56c43f394f38d7a7d9af548d903c3 docs/models/templateobject.md: id: b9980666bbc6 - last_write_checksum: sha1:096691ca4f390d832a7458fbd665a94317a6a751 - pristine_git_object: 417d2a6baba0d466c212ad4c4429517655bb77c9 + last_write_checksum: sha1:6a394a66c700f77287e964255a2faceb7c34dba1 + pristine_git_object: e3221c9fb88c7a65fb0b72cb59fb210b4d10161a docs/models/templateslug.md: id: c0aec132c3d8 - last_write_checksum: sha1:e69dc18cbc233df65b92061ff8a4120151180a50 - pristine_git_object: c0b97dfdb8fe4f7716f209147ac574f89cd24787 + last_write_checksum: sha1:db4aa6d51a1a9f323144ceb17514c9d51bd0de25 + pristine_git_object: d96836c2d39317449ddbefc8c5dc4c31c912fdaf docs/models/templatetype.md: id: a4988ff24e23 - last_write_checksum: sha1:2705a2e3a96b114366e882b4ed1ed72c68e34769 - pristine_git_object: cabd96ac9d7959a9213e66f2b387eb5cfcb85495 + last_write_checksum: sha1:63654dfbb355fbc2cc4c50806057d37236753930 + pristine_git_object: 74834f59d15fdabcf85e54ae9d24d01a56a62c19 docs/models/testingtoken.md: id: bddc4722ebb6 last_write_checksum: sha1:3fac66e5b0828e943ff1391e3933c525a5899a01 pristine_git_object: 3785f0a59572feeafb543fbce5a437ca8617f2cd docs/models/testingtokenobject.md: id: 67042d0614f0 - last_write_checksum: sha1:3f52100d8fa548a556e5fb81cf5016566670079b - pristine_git_object: a9dd8c0f056ba3c24c886d63447b65d408af8c63 + last_write_checksum: sha1:462344421b467fee40751595a296e04cef58d7c3 + pristine_git_object: f5ceff1372e83cc6f27f6d9c0d1977327e3d5c16 docs/models/ticket.md: id: 891e4063e056 last_write_checksum: sha1:3264a18bf4301282b434f82decff69e56bd92497 pristine_git_object: 6d1aa9bd2b0864fe0be5190c4b42a712d07c930a docs/models/toggletemplatedeliverypathparamtemplatetype.md: id: 55f9345ea32d - last_write_checksum: sha1:5261ae3d79da3b7b047aa9a8e26646a2dab1af58 - pristine_git_object: 11aebaf52d890b5ae7ffa5ea37bab391177cca1d + last_write_checksum: sha1:495fbc6ef67ae0487b61e3daabf325a1d2e25ec9 + pristine_git_object: 8711c00f3e0afff2b104798f91e204640989acc9 docs/models/toggletemplatedeliveryrequest.md: id: 11d1ac9e0706 last_write_checksum: sha1:df09a1b63a6631db12d62d9023e104467fdedd17 @@ -2176,30 +2308,34 @@ trackedFiles: id: 46126814fa13 last_write_checksum: sha1:de5a88c6694922bc3ba446499147fc65cc0a2dd8 pristine_git_object: 4b1f5a36764737ba3e4d25f30605a43621797fdc + docs/models/tokenformat.md: + id: eb5b2802d2c4 + last_write_checksum: sha1:1160c4cb5eb52ba5d8595a78f151e8996bddea76 + pristine_git_object: 013b723ce089d98643bfadd87d030770ba541127 docs/models/tokenobject.md: id: 98bdb379ffab - last_write_checksum: sha1:01c402559d65b46c936876ff702580eda0c5c3e0 - pristine_git_object: 724c890d709d3ef5bd0db67663e6b6021d05a5d3 + last_write_checksum: sha1:44d6924b55fe3f1bb1cfdda9d7e1e1361ee360c1 + pristine_git_object: 82481f29e676821fb17486b1a16caf1bb86ba788 docs/models/totalcount.md: id: 3114be6dd6eb last_write_checksum: sha1:d9e5d8dbe1f2d6a7d0e0e3cc50407b754097a65b pristine_git_object: f72c63b13cb7515efeafec6c111248e68e6c7e78 docs/models/totalcountobject.md: id: 5e0aa43a51e4 - last_write_checksum: sha1:4b225d6567212fdc9517840f67b5feace5ea2d20 - pristine_git_object: 4781d70a60a616453d0255ede5beca4de29fade3 + last_write_checksum: sha1:4420f806ccfb5c94281b847bd962b24cd09730e3 + pristine_git_object: 3c3848f72661e12f6f3569ed8361ab8bf416c28d docs/models/totals.md: id: b4b5833c011e - last_write_checksum: sha1:a94daf071789587233c8edf9e4710c988994ae23 - pristine_git_object: a9b75ab839f99ba44b3eb20803d4b0904672eb5f + last_write_checksum: sha1:1a57541b15c095f1996b4bbd770ab1bb28d5eebf + pristine_git_object: 7c94d87ba2983245a7a69f024c72b6090ea5bf14 docs/models/two.md: id: 3720b8efc931 last_write_checksum: sha1:314e43073aa00a19e2de3bf0996ab0dba2bd583b pristine_git_object: 6351bace5391744cf56615eb7ba0942481096cb2 docs/models/type.md: id: 98c32f09b2c8 - last_write_checksum: sha1:88095923c540526d3094b1f533263ccf4f19e3fb - pristine_git_object: 5e7aa828aa4c786cf567cb85f58420efbab8132e + last_write_checksum: sha1:30b20d26f9bf3a7a2e28765a067e0c2223cbfb76 + pristine_git_object: d5d6e89145b04c4c0b94a2c8799c17691cc4b840 docs/models/unbanuserrequest.md: id: a129633ae58b last_write_checksum: sha1:f527b4151b1ccd6b52331e272c74bdcd66886345 @@ -2230,8 +2366,8 @@ trackedFiles: pristine_git_object: 2a4f37801d41e841e59182185b273e1dfec3f7d5 docs/models/updateapikeyobject.md: id: c736c340b172 - last_write_checksum: sha1:7253d88bd213f81b521f3ed84222508798d1345c - pristine_git_object: 4bfe6132f372b04f2db41548f137fa46558b0a6e + last_write_checksum: sha1:698f886d21de145ae862b02f90aaab385df7a57b + pristine_git_object: f164a890f591985523bdf6b525547c30482db5ac docs/models/updateapikeyrequest.md: id: 8afb254eec18 last_write_checksum: sha1:d811545bbd0f77fc6a17eb5f949188cb5537d948 @@ -2264,6 +2400,10 @@ trackedFiles: id: 6a3f56f25720 last_write_checksum: sha1:3089b91e457e5b68e9f77d95baa48bb49a6bdae4 pristine_git_object: 91bf6f62cedb343ecb69dc8b6b6ebaa6ec2bc383 + docs/models/updateinstanceoauthapplicationsettingsrequestbody.md: + id: 3f0d1327b7d0 + last_write_checksum: sha1:8965f27f559bb91432af3b444b0e0417308f54f7 + pristine_git_object: bcf185cc01c2a1bc342a896bff684adf36ad8f00 docs/models/updateinstanceorganizationsettingsrequestbody.md: id: 2f7feba9be1a last_write_checksum: sha1:65cf4fa24922ec829a59eae305060e46328d6093 @@ -2378,8 +2518,8 @@ trackedFiles: pristine_git_object: 8a9d6d76f2782e05ce5a94a538caa32ea27b0d09 docs/models/updaterolesettype.md: id: d21bbd5d24f9 - last_write_checksum: sha1:ed5ebbdac18331b3b2a9ae86ec304f3fc6bb517d - pristine_git_object: 773d4b6c3ac984d236ec386b835964e55802bb3e + last_write_checksum: sha1:6840531271ec2b724927c8a2b409387881f1af98 + pristine_git_object: e662a7c2d05633a4afb3d510011a99dc8686330a docs/models/updatesamlconnectionrequest.md: id: 208f59a75cda last_write_checksum: sha1:1e8ada30632b00cd8240d4cac0e2a6c461ea8620 @@ -2426,8 +2566,8 @@ trackedFiles: pristine_git_object: 75a86c3588538c3ffbbd4a46d8ac49fcb97a7390 docs/models/upserttemplatepathparamtemplatetype.md: id: 3af1f6044619 - last_write_checksum: sha1:0e42f1f0dd965ebc7b25947bebd9924a51ee4090 - pristine_git_object: 347c2609d72cd46a0579db4781c6cedcc608282f + last_write_checksum: sha1:46dd8d065873ec72888164d2d3f7828489bba5f4 + pristine_git_object: 53fe997316c70ce2f41556124c5b0f4cba013456 docs/models/upserttemplaterequest.md: id: 5bc4ad14155d last_write_checksum: sha1:90557f2c42308e9495e5f08e86b0b787cb3225f5 @@ -2442,8 +2582,8 @@ trackedFiles: pristine_git_object: 5670167bc19cfdcce70cea0436ccc5d5017ceb6e docs/models/userobject.md: id: 520306a3cd1c - last_write_checksum: sha1:5f2fc13d46a8a20f87a922aa16c322fb3e7cb170 - pristine_git_object: 5ebea17321ef50f924e2d90b60b7397bc34349dc + last_write_checksum: sha1:4646eb089f3c7296486f34879f7d024f947de1c8 + pristine_git_object: 0e53566fccae9b3e4bda6c6a0b2f756f37ccb596 docs/models/userpasskeydeleterequest.md: id: b069689ed99f last_write_checksum: sha1:9701cccc306f66cf5edf66eec68b45dfe47d3934 @@ -2454,8 +2594,8 @@ trackedFiles: pristine_git_object: 822e28b6da050861911320b9b777f43a0c768c76 docs/models/usersgetorganizationinvitationsqueryparamstatus.md: id: de275afa5dd9 - last_write_checksum: sha1:a1a0cb02d72b50f2260356c491175252876bb7fe - pristine_git_object: e59b4c3925bdf810b9187987f503cafa644db644 + last_write_checksum: sha1:e31a93ac4d7740a71f079011dc9151583f30faa5 + pristine_git_object: 91f75b22c60596147a4e6941a66d0f790116308f docs/models/usersgetorganizationinvitationsrequest.md: id: 737ddf543480 last_write_checksum: sha1:03e10c3f2dc8a0dac7ea7e7573aa7af9ae5436ec @@ -2490,60 +2630,60 @@ trackedFiles: pristine_git_object: 130b46bb6dc834fa2e45413f4212a32e3955d08c docs/models/verificationadminverificationobject.md: id: 3380f4ba3847 - last_write_checksum: sha1:808edbdf1a6f5ec58511457c49dc8dc12b8183b5 - pristine_git_object: a2640269a3b1845e78015b3e4b8b5b4fad546f24 + last_write_checksum: sha1:bf37ba87a1cb3555013ba6718ac297088700fbda + pristine_git_object: 1792a82af8b7945abf2d237f9877dd427aaff0f1 docs/models/verificationadminverificationphonenumberobject.md: id: 3665fc368a2b - last_write_checksum: sha1:2d3e847a6c4f3ebe223b7aed3ef4e92b07c9aab2 - pristine_git_object: 89e30c11f7b01327f6e3787fe20f7f441e9cfcc3 + last_write_checksum: sha1:31d6612afd32b65e3a99791d1402a6fb19e78b35 + pristine_git_object: 15c697b8854e822d0b6965b62cbf776ff54a3530 docs/models/verificationadminverificationphonenumberstatus.md: id: 6a09ba3aa3e2 - last_write_checksum: sha1:61af6e6dc9201c7aeb74694df9e065d748f87f70 - pristine_git_object: 09318d5167d929e107cb70e93fddfdad1dabe9d9 + last_write_checksum: sha1:0e039199c4827d0a53a1f357e62753cae802436c + pristine_git_object: 832be595fb816e27fe03a4e1df35a66351005990 docs/models/verificationadminverificationstatus.md: id: 69be5805bbce - last_write_checksum: sha1:0922b6206155377418e88b924bc16c8808404ae9 - pristine_git_object: 492e9e54f0def029032ec95b8d0a51c3cd22b62b + last_write_checksum: sha1:d00e8f9f55c0eb220ab52adef12206ec7e26f184 + pristine_git_object: d931d3c3bc037e9d22ae62ca3b26b994fc489cad docs/models/verificationadminverificationstrategy.md: id: 2677168fb00e - last_write_checksum: sha1:d6b2c6623c072171fd85739cb4a891f908450144 - pristine_git_object: 0345d1ca2cd628a163e041cdfd9af14b7d86b95c + last_write_checksum: sha1:fc1fcaff08aa5b534a28d3af641acb6dedba94ec + pristine_git_object: cc12e85ffb2e79cb71d5eeaddcef570a5a9d7910 docs/models/verificationadminverificationweb3walletobject.md: id: d092dff6989c - last_write_checksum: sha1:e6a807c2b914e69ed2e6d9c1b4ee6bb1bdea83ca - pristine_git_object: a232c1c2229d78439fa191bd1986bbd21c1a3b4e + last_write_checksum: sha1:0267d6bab035aaab983f73e6f73540683ce2cae7 + pristine_git_object: 5256b87cc95362d2465dbc56750a6c402cd5d01a docs/models/verificationadminverificationweb3walletstatus.md: id: d9e695bb3787 - last_write_checksum: sha1:bf7d43edf044d9b8e66a6a74a14db17b1bc5424b - pristine_git_object: e0f8d8f7a91f88317bf12bf0cead598b398a0e42 + last_write_checksum: sha1:dce404e7fb05fc8ca062a9e9d81b7e6256cd5735 + pristine_git_object: e9c8bd004282fbadbeb26fd201ea0a6a794aa55c docs/models/verificationadminverificationweb3walletstrategy.md: id: da91fbe8a7da - last_write_checksum: sha1:ff5a757f24c3fab8c096db30531ad853fc2bf7c6 - pristine_git_object: d88ebe77dd990190ee14663da4af0106dd856861 + last_write_checksum: sha1:807808f5ab3e834404c0539cf9b71f77b400313d + pristine_git_object: 6675fafa67b9b9e24124f077909191682b232a57 docs/models/verificationemaillinkverificationobject.md: id: 4af950f44f2a - last_write_checksum: sha1:be9baa5c2e5a00bd924e900082bc5a36d52b533d - pristine_git_object: 7267283eed292e679fcb1c3a9ab342c31a05735d + last_write_checksum: sha1:770b20d41b07fec6e826a39ad66e7e945e4775c8 + pristine_git_object: 44188c2c5a2c25a0104801977601c4868cf1c07e docs/models/verificationemaillinkverificationstatus.md: id: 6a2d804c47ae - last_write_checksum: sha1:688579aa262e79ecc140b42c2a4e8aaa8be0712d - pristine_git_object: 8d56820375336f117f29650824e2074bdd3fb156 + last_write_checksum: sha1:a9a5aa2b8754a065e68dbcfc4cb9b8f87c51b4e2 + pristine_git_object: d8d9876d648a90bd025b3ab0a856351ac5170c75 docs/models/verificationemaillinkverificationstrategy.md: id: 8a6b501b924c - last_write_checksum: sha1:f23b0e6d9ff0078e89938c1dfadfc1532af62033 - pristine_git_object: acee69d86f58eec35ca31690a576bec0480760e6 + last_write_checksum: sha1:ecc885cf9726a1e1e940321d4a9952e56cfec05d + pristine_git_object: 900468658227fb1b492776478db2c7e33842a5d1 docs/models/verificationerror.md: id: d12a75d35a40 last_write_checksum: sha1:2d3f7dac917f21e5eefe23c05619a68d902694c0 pristine_git_object: 5ab1d2c75a980c1e53f5eede0cae006819ddf608 docs/models/verificationfromoauthverificationobject.md: id: 5d490d0c3e14 - last_write_checksum: sha1:f82913af021af1536f1af3b5c14ea269af8e73f4 - pristine_git_object: 7d9d4dfe51c63439ace3ebaa9ff76e0863c89ae7 + last_write_checksum: sha1:3123110fe827173d691263e3900495f15dfaa15b + pristine_git_object: d48e5498f7d333b65efcd889f16565115b687d7f docs/models/verificationfromoauthverificationstatus.md: id: bc4601d642c0 - last_write_checksum: sha1:c32838c5b5ad741b430ad07a7c631f04b01f287b - pristine_git_object: 460b707c399a30b9824489c1962fc7b621197683 + last_write_checksum: sha1:4afd888127dd1e88cb3cdd3c883ec79c6cffadd5 + pristine_git_object: 8c5f1bb3c5dd31a7fab7afd309afe5a842cebbf6 docs/models/verificationgoogleonetaperrorclerkerror.md: id: 10131e87b3f0 last_write_checksum: sha1:0bfaac999719fad5a1fb8ad9c516fa769e81740e @@ -2554,16 +2694,16 @@ trackedFiles: pristine_git_object: 10477619eda4b00539751ed18c4ae3ee1e3cae47 docs/models/verificationgoogleonetapverificationobject.md: id: e697910b1071 - last_write_checksum: sha1:a1d6b66275450317577c056f081aff793e3ec2d2 - pristine_git_object: 940ee524d948be5341c30a6651791fc33961ddc2 + last_write_checksum: sha1:b9dc88be233294487ff03c7940a4afbe23293a5f + pristine_git_object: fa037776805e045e3208a87960ae272a12e20fc0 docs/models/verificationgoogleonetapverificationstatus.md: id: 467da04fbad5 - last_write_checksum: sha1:916fe8eba7da84a28f6c8a27aea26c60e0f6eff4 - pristine_git_object: 496402a3006de2e378c547e7eadca2f1d90d88f0 + last_write_checksum: sha1:78331bf1b6d8e92a9105fe89e92431e0205d0c82 + pristine_git_object: 0345ab6c4685ea6727d5ce16b92d834adb5acb27 docs/models/verificationgoogleonetapverificationstrategy.md: id: 0685af017f11 - last_write_checksum: sha1:a1ba87b70a4f63e61f1612286a8e8dea75aa9179 - pristine_git_object: a29c99ba631c1b78b2fa82812f32e3d671cd7fa8 + last_write_checksum: sha1:401025428b0e1997ed142595f754a299e8997e95 + pristine_git_object: bd042be8f4a5dd5e3b2311148de55912a4d415be docs/models/verificationoauth.md: id: 5af3c6960a9c last_write_checksum: sha1:599c44803b9ba8fe63c08bb96ab0f5f46c44d959 @@ -2582,60 +2722,60 @@ trackedFiles: pristine_git_object: fb06e038d0cd2bc8d9294bf435408bf64e1c168f docs/models/verificationoauthverificationenterpriseaccountobject.md: id: 876f67aa3613 - last_write_checksum: sha1:81d822e1131e5375d5e221ddef2ffecf0d05efac - pristine_git_object: e25ace1be6a770b1e1906bb7217898c68fed6345 + last_write_checksum: sha1:8ba67c8ee5ed4dd5468e1091a4e154e5a2321c0c + pristine_git_object: 0d71193736ad1b3401bc8d48151fdac6cab6f3de docs/models/verificationoauthverificationenterpriseaccountstatus.md: id: d81277b2f936 - last_write_checksum: sha1:f8a16910dcb7375557decd2c0b22f82dd60172ce - pristine_git_object: e6f4a7a192c328f2a81e0fce8d4bccdfcd00a239 + last_write_checksum: sha1:275dd65e96f88c863a21825bb15fc9dc7ea2db0d + pristine_git_object: 88f027b721c1621c00627bbdbcd2eac13722bf96 docs/models/verificationoauthverificationerror.md: id: b30b9143981a last_write_checksum: sha1:dc16df5f51e3bc08bad736a00df68bb35dd484c9 pristine_git_object: 11f0b7b973783b3b1d83092a993125a126cef4d4 docs/models/verificationoauthverificationobject.md: id: 220a870ec485 - last_write_checksum: sha1:2fd773a29c714f9eb04fa271627f62fd2d90cbd3 - pristine_git_object: 00910eabe1a6919d8ae144d5fa81bb2c5ffbdb18 + last_write_checksum: sha1:7672e013bd5254d12bbd805c286a1eed0a84af68 + pristine_git_object: e8ffa2b39dc61eab6c81e4ae996b49470b96e221 docs/models/verificationoauthverificationstatus.md: id: 3f3887b82e8b - last_write_checksum: sha1:6ee63597302d0bdeef16f085e9ebbd3f0c61f8a4 - pristine_git_object: 20d773510d52dc5330eea3ff1174950fe22fb51a + last_write_checksum: sha1:a540f03b120011748abfd56538771172d8415cc0 + pristine_git_object: 0f3286c787cf99da3f42d0b6f8c8c15ad42f2741 docs/models/verificationobject.md: id: f91501d19a86 - last_write_checksum: sha1:8cf2b37411e8694dc2589215fcd606f383dbfe9b - pristine_git_object: 17343181d6568296ac1f854a262bf048e02c0443 + last_write_checksum: sha1:b138045dfaa18233d9a7be072714c4e98ac7cfb8 + pristine_git_object: 4bf8f26a2ee68383e7ca2cf2077b31d6a1625a49 docs/models/verificationotp.md: id: f116e81259ff last_write_checksum: sha1:f5311d7ddcc00189cafce7e009cd8cc88f9d8875 pristine_git_object: 0e6596b5c8a11366f5f7c22d131a28efc41b1553 docs/models/verificationotpverificationobject.md: id: 3eddc52642b7 - last_write_checksum: sha1:63a8ca1d9c5434cb9b74cf1c5bebde25b994bfa6 - pristine_git_object: 111ddb194d24175f250826cb2e620b4852426cc6 + last_write_checksum: sha1:03acd3fa93e6ced696ec106541b440184f08b7a2 + pristine_git_object: 0be73dee4614d99c5e5efde854de7641d93fd220 docs/models/verificationotpverificationstatus.md: id: d0985ba28a8b - last_write_checksum: sha1:d53832099de6fc05337b9d98de77eef8172564cf - pristine_git_object: 4e667bf37010ce37848114a14b198830eccb7a52 + last_write_checksum: sha1:8bfac7ef24cba9f2e155dd304372733240417e9d + pristine_git_object: a022a3451637ce46048cd2f3a3469d019dc6ccfa docs/models/verificationotpverificationstrategy.md: id: 79f4604708d0 - last_write_checksum: sha1:07bd8fbd5f9e6ad176cbf5e0e931fddf5a462c8d - pristine_git_object: e89a021ab0da3dd5536cfdae286f737458e10ef6 + last_write_checksum: sha1:1cd01e3d37a8fc4ed0879b3e5751f525ffa3153d + pristine_git_object: 97abcecb600d890d5619ba2a509fd381dae08099 docs/models/verificationpasskey.md: id: 24934f327835 last_write_checksum: sha1:fb05194be9a9e4bd5e785b2bcbed5edf79bc66e5 pristine_git_object: 16b8b311db0d6349be33f427cc1ab3b599dbd2be docs/models/verificationpasskeyverificationobject.md: id: eb8c5fcf4dd6 - last_write_checksum: sha1:62fe6c4d13c1e6a9df7f446ec6fdf5c8f965b677 - pristine_git_object: 1426d616d67072e2be19ee0a2107c2992ef1a36e + last_write_checksum: sha1:27ac1b501ae15827dfd9f6f4e3e40047564fc288 + pristine_git_object: af605caf6ad5219f13472c8c9e3ba912865b4c3b docs/models/verificationpasskeyverificationstatus.md: id: bbfcee0c50c8 - last_write_checksum: sha1:fd9363a142fd42a3d0b6812a6ef63b18ae9e5ef2 - pristine_git_object: 873e24aeb0991f4ab4ffb69d374b7134b8677046 + last_write_checksum: sha1:03ca3fc3935aa9becb9c45e0fbf6b84b82c25808 + pristine_git_object: 79efaea2cc8091eddb13da7aed932af8458ad21e docs/models/verificationpasskeyverificationstrategy.md: id: c15bec37802b - last_write_checksum: sha1:11dbd4282de770ccb1ad241bf21ba2c3352be1d3 - pristine_git_object: 3bd7d5de1562b341dce1b9e879f32c2aea6dc363 + last_write_checksum: sha1:c420d1749d57d3c6a9eb9d247fe07da5b95e7a34 + pristine_git_object: 96d46687c4d5d2d217434fe57fb3c15108dc6c85 docs/models/verificationsaml.md: id: 1c8eda29317d last_write_checksum: sha1:164b3725c1637e474957ce51f8cbb7bd4fec0402 @@ -2658,116 +2798,116 @@ trackedFiles: pristine_git_object: bf58e86e3cd47da94a13e8e6361c8db98fcdb818 docs/models/verificationsamlverificationenterpriseaccountobject.md: id: c91bb949d504 - last_write_checksum: sha1:203d65befe5d2719add1310ea767bd9663e658b2 - pristine_git_object: 91e4385ab5db71b7ae583f14911218fd54b196c6 + last_write_checksum: sha1:79cce21200b5b4f9049fa55339f566ceaf2ebf35 + pristine_git_object: d15664affb1374c140afeb8dee92bc5c19f313a6 docs/models/verificationsamlverificationenterpriseaccountstatus.md: id: 6381e7cdb0de - last_write_checksum: sha1:5adcbc644e515f08fdb7a920e013f21023efbd6e - pristine_git_object: ff668f0db51c41d04b4d087de2b971595cb4be2f + last_write_checksum: sha1:e7f4ec4cd529536a38936be8da8e365b380e30b9 + pristine_git_object: 077dacccb5b7fa272b367cb6b8f3b03d2c31cc5b docs/models/verificationsamlverificationenterpriseaccountstrategy.md: id: 58251e383ad4 - last_write_checksum: sha1:2e0a0bda95eb558b81072a74fecb1e755d065324 - pristine_git_object: 6c97a442eea849c6be598275e92df787b3e9f785 + last_write_checksum: sha1:da8c98503217b982193b5feb2f52feab9970b1d4 + pristine_git_object: 601dd9b11233f7b9805ec7aa1ec145bc8c1d3782 docs/models/verificationsamlverificationerror.md: id: bc17ff547402 last_write_checksum: sha1:1a85204779cca66dc73aa010ea8fe1de751dc9c9 pristine_git_object: 66ed2ad5a1b79ab49b0773de4e03f90aa68e1a62 docs/models/verificationsamlverificationobject.md: id: 92103042ee6a - last_write_checksum: sha1:48c4dc9c5e1bb4d13aee7448e51dcb2945616ccb - pristine_git_object: 0675d7b0ce366ecabd4c7ff53ae991a9ff185fe2 + last_write_checksum: sha1:429c40291897b05a1d3bec68bca1fa0657338960 + pristine_git_object: 05dbcc6d4d2b53adc5b2de34a1cbf4aebf0ec854 docs/models/verificationsamlverificationsaml.md: id: 3421875ab859 last_write_checksum: sha1:392dc0f917fe83a1caad53836d05bab6882e1ad2 pristine_git_object: d7b9c7a9c194079a16847c8953c49c144ac761e7 docs/models/verificationsamlverificationsamlaccountobject.md: id: 31425a415fed - last_write_checksum: sha1:8ecc974a1add8ffa50891ac81ff69bbf7d86965e - pristine_git_object: 79a9ebfd43e4245efc2fae4d300243cadac34180 + last_write_checksum: sha1:0246f95c9a7581d775d18e9f9f54ce567c2b0c43 + pristine_git_object: 55ab04b0ddfed295dd2b586dc09bb076ee64b9bb docs/models/verificationsamlverificationsamlaccountstatus.md: id: c79ad9e19002 - last_write_checksum: sha1:375e43f0bfbcc347217e5f748a008ea36e45ebd9 - pristine_git_object: 645ee8513eace752cde725fcdd1cd462810b81bd + last_write_checksum: sha1:d60f8acdb9293a7e343a675965472c2aaa980413 + pristine_git_object: c228919bd86ff007911fecfe342f94fc18924b85 docs/models/verificationsamlverificationsamlaccountstrategy.md: id: 8db1bfca6e8e - last_write_checksum: sha1:af42c2db9055714e0c43517ebcf9ab572a4155c8 - pristine_git_object: 4aa285a133b32133f104a8efd204322302a57431 + last_write_checksum: sha1:b2fe286501d5047209ac75051a1ebce1ff7b4b28 + pristine_git_object: dfc3579043162f35b9a2a45f38024d4ee8a829a8 docs/models/verificationsamlverificationstatus.md: id: b7ebf472783b - last_write_checksum: sha1:57346a344f8765a13f4f5b881ace8fb7ce359765 - pristine_git_object: af3160087141fb139439f93484f85b2c4366643f + last_write_checksum: sha1:affa66054dc3cf4ed42c4e9f0ceab0651ac2c7dd + pristine_git_object: 4afe3ea3a22318a49fcc7ade8fadc4cf8d93f38d docs/models/verificationsamlverificationstrategy.md: id: c86f987fe2e6 - last_write_checksum: sha1:30f6ed8a79e20ade21babe7c04cbc0105e93db76 - pristine_git_object: 990f20fbfceece2fac27fa46b5c55de3c7a94b0d + last_write_checksum: sha1:3fbfea7c917c5461bd43401239d2a5939bef66ad + pristine_git_object: 45ab6a8b69ebfed7b3ce71ee17925e34f5097d35 docs/models/verificationstatus.md: id: 61319762cf72 - last_write_checksum: sha1:18e6a12a02f01c012c00f9b9036e4854cfa49daf - pristine_git_object: 7da7c68af6c69f0266c0445cc872adf2be057a40 + last_write_checksum: sha1:1122c557ab3a20553829f387ef220fb21dee27db + pristine_git_object: c7cefe352275836feb51198b7b9f15640802e578 docs/models/verificationstrategy.md: id: eca10e68b6ac - last_write_checksum: sha1:96f551f01585f785c74c33c5b159770ae93475cc - pristine_git_object: 4cc127f7cfa98a86f80d8626c4278c1f7c38f4dd + last_write_checksum: sha1:9dc60f0d0900de2c89e842aec62bf15d17d47fe7 + pristine_git_object: fe19a684e34afc6b8434e712a7dadd8dafc70d12 docs/models/verificationticket.md: id: ea291fa788af last_write_checksum: sha1:938d017008866600531f0ecd2c250afd76c9f265 pristine_git_object: 6d075c71abe964c0613594d3f5617e5952f03e52 docs/models/verificationticketverificationenterpriseaccountobject.md: id: 24140a9c2e01 - last_write_checksum: sha1:6ffaddda4f5838817e624cf09355bbb60bf75359 - pristine_git_object: c110276f0aeb0c9abdf6b3769ae6cab7d701cd40 + last_write_checksum: sha1:119bfa98a552558834c1e92fe4a7bca403357978 + pristine_git_object: 837647f36cd1ec3bcc345399f41280f3d7e51f48 docs/models/verificationticketverificationenterpriseaccountstatus.md: id: 11c0f2c2e8f1 - last_write_checksum: sha1:28df4dac0754a93368c3f8bfecf2c9763392ed9c - pristine_git_object: f3bb0a4eb50359898116fc49763cf1e52aff0ffa + last_write_checksum: sha1:0c3e76d77a6d6e7a621dc08e71278720ffbc8b1c + pristine_git_object: 8ac07ac8522ff9853179b9eec014a1deab66b8dd docs/models/verificationticketverificationenterpriseaccountstrategy.md: id: 4ee505885c25 - last_write_checksum: sha1:aecfd29324ed67e58ec7a9c0408d24d7e453f216 - pristine_git_object: 6c7faca74495cfcd28295da6b04a82ff66730e52 + last_write_checksum: sha1:a574fab2fc99b028a45bdf4896a1f9712f3d0baf + pristine_git_object: 4f42dd4830f837b2dcefe73369aa8458e560db9d docs/models/verificationticketverificationobject.md: id: 2c2f7a358092 - last_write_checksum: sha1:9fbfc976680f5ed15e09b8045c016f30e8e6721e - pristine_git_object: 915cac663acfed24ba61fe56c610cef8bf4da313 + last_write_checksum: sha1:12f59f44423dfbf022a426e757b5ae0239fa6b66 + pristine_git_object: f03c85c70c604e71297e41971cd0d124bdd21ac6 docs/models/verificationticketverificationsamlaccountobject.md: id: 328a5a7bb9af - last_write_checksum: sha1:a0e4ffbec9c103dfdf0717461f947a41132ef540 - pristine_git_object: 532ca5632bb6847a6e7c6c6e138509d3b2c71e33 + last_write_checksum: sha1:3d8238e564e71a749ac9162c7d49f0d009b95783 + pristine_git_object: 39b03df35408da2367aed5fff079d59d3ab45eaa docs/models/verificationticketverificationsamlaccountstatus.md: id: fede5feb9d3b - last_write_checksum: sha1:ec9cfca9114af91ca149d6c4a7d58db4eb1384e9 - pristine_git_object: f956f55468b9ac4356835ef02a93c942292b71ce + last_write_checksum: sha1:63ca335e79203e6db6d90acd813c9ad80f29cf6c + pristine_git_object: f87aa0ad29014ed7e769781417407607f5a314ab docs/models/verificationticketverificationsamlaccountstrategy.md: id: 409c6233c430 - last_write_checksum: sha1:871e03c93040c6f7a9da4642bd448d6ae8ff96af - pristine_git_object: d5b0d34db4b10de78fed35975ffc0b7d167a0a9d + last_write_checksum: sha1:065d89c132b83598becb5a6ba3edba2f3d8d1526 + pristine_git_object: debabfc1e0b4beb6107559398b2271f2df42929d docs/models/verificationticketverificationstatus.md: id: 011ce8e2331c - last_write_checksum: sha1:89e378723399a1f9a05f32faf39d936b23921f5c - pristine_git_object: 28ee3fc455992fc435b21ef95554deacf5a5fedd + last_write_checksum: sha1:b214c6666588ce7ca2f2fbcd762270c352063d5a + pristine_git_object: 34dc6be5a781f0ceedfdaeb2d7190b3558af0bac docs/models/verificationticketverificationstrategy.md: id: c283108322db - last_write_checksum: sha1:609e0a0f4e36705cffed50cbfc5efb98582676fe - pristine_git_object: d60e974fa24ff29ec8617a1c2abc881b0d269082 + last_write_checksum: sha1:c90246efc4abfebc9f36effc5c9740ac2ee77cd4 + pristine_git_object: 0abc88f6d798134a824995a311a85fe3055bdbbe docs/models/verificationticketverificationticket.md: id: 20b480b5bcf6 last_write_checksum: sha1:b0641adada725ba6aafded44a912cf467e90a962 pristine_git_object: c9db8df9b2c8761a5895bc240dd40dfb9c74e385 docs/models/verificationweb3verificationobject.md: id: 1d997f597b3d - last_write_checksum: sha1:0308894068f9b3b49f613e4bb6535e2114f7c4d3 - pristine_git_object: 9a695cd49398c61e4517730333fff3ef4b360ec7 + last_write_checksum: sha1:ed4faa031b26f4cfeca83214347f30f4c2a8ce84 + pristine_git_object: 2d580512c3b0fc8ddf2c74021ab64de7988e18e6 docs/models/verificationweb3verificationstatus.md: id: 99f48eb92ace - last_write_checksum: sha1:a50845f3280cbb52b5eed94384f3e8d51274556e - pristine_git_object: c4e551ed6c3e0e337da7a335c0be82d30bce888f + last_write_checksum: sha1:f4ca179a1b8feab980678a133a91ed59017c0222 + pristine_git_object: 89053c0ad2da3ad5b2f9e95915ae0e2d4f876cd3 docs/models/verificationweb3verificationstrategy.md: id: 3ef5a5affb55 - last_write_checksum: sha1:bf176d673b4575d59eec735930828692ee068ae5 - pristine_git_object: cee04885558ee2642034ec7e8cf3d438ad6e048a + last_write_checksum: sha1:650a0e818b7d8b88472639bb12acff70f5005dd1 + pristine_git_object: a0bedf78caf5be436d90a058eee52ee13f0911f9 docs/models/verified.md: id: e436af36844c - last_write_checksum: sha1:ac3bd316677e705b1e4cec6706353f3ec0d64d71 - pristine_git_object: 0297cdff7b101107ae9b21aa968148e152de2913 + last_write_checksum: sha1:89d63b7b3d941f51619a2f4619091e5943c0b85b + pristine_git_object: a710da4c72676c9e9804c4fc24b03eca127b6c3f docs/models/verifyapikeyapikeyserrors.md: id: 5466830a03e5 last_write_checksum: sha1:45e888672259e9d807145fce30ac0185f4745ee9 @@ -2786,8 +2926,8 @@ trackedFiles: pristine_git_object: 600e19dc7133a439bfcef4ef29a4b80ae1c94ed1 docs/models/verifyapikeyobject.md: id: ae69859a622f - last_write_checksum: sha1:4b44f73b9770c442df4961f79008b9af889e8272 - pristine_git_object: 8e332a6a9f983029d721663f42a58f1278383e1e + last_write_checksum: sha1:b606021329bac47edfb5c159864429013353834d + pristine_git_object: 30dbdb4deb7f7fd1360f254367845692f4b24f9c docs/models/verifyapikeyrequestbody.md: id: 9215c0b56fe7 last_write_checksum: sha1:43f5908e452c3c634a379adefdfeed13cce06bb3 @@ -2822,8 +2962,8 @@ trackedFiles: pristine_git_object: 7dc94dc147083c06da6ebf801422549c2a22a949 docs/models/verifym2mtokenobject.md: id: 9e41e124a68f - last_write_checksum: sha1:bf63e78665b4eed2005a11f2337a44ae9ee6e0d4 - pristine_git_object: 89c81a3fd76c46e59cc59bbd4eccc63749ca9fba + last_write_checksum: sha1:c290d2c54c8c79e5d2053f28c825ecab24be436e + pristine_git_object: d57045e75e7e1ff3fffe59d28ca11aee2463e165 docs/models/verifym2mtokenrequestbody.md: id: 7933dd4644fd last_write_checksum: sha1:39374984e9fe1292c931f6f7c2cd0c4682dab9c8 @@ -2894,20 +3034,20 @@ trackedFiles: pristine_git_object: 16d5b35cef0553b919bb278df463d307ef5a25c8 docs/models/waitlistentryinvitationobject.md: id: 1ef37624dcb1 - last_write_checksum: sha1:146f69a18e6b9a914a3b6ad27ef51f1135f17418 - pristine_git_object: 10427b5fa7b161ae5a810c5646a79064e15108fc + last_write_checksum: sha1:970981575ee8451173d9eda7769fc0d1d30eb2d0 + pristine_git_object: 4a9b707f681561f8ccb8b1f1ae267a803b6fc635 docs/models/waitlistentryinvitationstatus.md: id: 9f5b8f53abf9 - last_write_checksum: sha1:22f357e635ad55bdffa794586946670537fcfaf3 - pristine_git_object: 4e0aa7f640304747b028eac4d260ff82d74b44fe + last_write_checksum: sha1:f16480d164425f6312d127aa7aa3af152656ff67 + pristine_git_object: 595dbd8a017dedcc271778ba1d7eab565aa6bf17 docs/models/waitlistentryobject.md: id: 189fe94bc306 - last_write_checksum: sha1:81aaef4d2b6daafb6ac7a501e6b5e5e8a52ad8ac - pristine_git_object: 33429077b805207833090688c39584f7b947bdf9 + last_write_checksum: sha1:c3bd0ef629c093cffa90541b9dc2c27a523f2bca + pristine_git_object: f6ef06982e4f944e08efdfea399071ed28c455c8 docs/models/waitlistentrystatus.md: id: 4edeb4996b14 - last_write_checksum: sha1:3edd1e44eb341bdaa8be9161a106139917243623 - pristine_git_object: 65b1c1db97d8f455de25ce9bacdb87528c6baf7e + last_write_checksum: sha1:9da577b53339d3be060265e00e1c08c2e2c82c58 + pristine_git_object: cb55428ca54f2c1427ef149b8975ddaf0472c281 docs/models/web3signature.md: id: 1d3bc8b8684b last_write_checksum: sha1:28d823390a6648974df756168f838d5a986fb0b5 @@ -2918,8 +3058,8 @@ trackedFiles: pristine_git_object: 345944c666c0ef7528f67892ffd5992594213597 docs/models/web3walletobject.md: id: 1a1af9f3294b - last_write_checksum: sha1:2baa28eccb6568d8bc6aa7f258410f59763f3e42 - pristine_git_object: e5f745815820e03d7fcb7c6356041b0662202f09 + last_write_checksum: sha1:b3cb10a51eaa13361d7a51f595a0fec02d2c68ee + pristine_git_object: 5357c560a55ec4595cda98e9faa7fdda9ea7f6a0 docs/models/web3walletverification.md: id: 85db2e2624f5 last_write_checksum: sha1:8fc002a1f78fa1d236c5da6f345bf51d22ab319b @@ -2928,6 +3068,10 @@ trackedFiles: id: d484142effde last_write_checksum: sha1:ff26c0f001ce2455931c306d3c8063f5a885bf56 pristine_git_object: d048d739fb5b2392930eb284eedea95d6efcd9a8 + docs/sdks/agenttasks/README.md: + id: 809f9d21a2ba + last_write_checksum: sha1:49e203c396b97973c3bf8e8e3e1bbd6739d295c1 + pristine_git_object: f82d65de22296c8ec3afe5f0a028e21d8e7ac1c6 docs/sdks/allowlistidentifiers/README.md: id: e8a186582c92 last_write_checksum: sha1:5800fd6e2a20cdbd4fc94980818405e696f6aa4b @@ -2958,8 +3102,8 @@ trackedFiles: pristine_git_object: b4c5071dcbedcd6a5f60034a54e00ed3055a40af docs/sdks/emailaddresses/README.md: id: f5fd208070d3 - last_write_checksum: sha1:76fce77e596430d27f35ff551bfe18b50989ba3a - pristine_git_object: 5179c8c14d4039730df2c90caaed6e1836be5363 + last_write_checksum: sha1:5889a7dfc387ac07e32e7c8cf70189ee1ddfbfd5 + pristine_git_object: 586ce69d5f7f8b6f2c95a99574e9e49c69948d1a docs/sdks/emailandsmstemplates/README.md: id: f97f5a6195f4 last_write_checksum: sha1:21182fc1ed3c6c111146691d07b034937d82f029 @@ -2970,8 +3114,8 @@ trackedFiles: pristine_git_object: 40d266c0ca71b4a042c1624998026a9565b4a627 docs/sdks/instancesettingssdk/README.md: id: acfc6e2cdd5f - last_write_checksum: sha1:44bfae1a90997773addfd6be76d3809e8e486691 - pristine_git_object: aa2a0d04e43d72abda2a11ccdb0738d764ae3c6c + last_write_checksum: sha1:c0ecee88e35b3aab3f32a36efd9f57f01caef8f0 + pristine_git_object: 851af1233f2ea10c6881e071039d6d5b872d4e43 docs/sdks/invitations/README.md: id: 4f20950f4cbf last_write_checksum: sha1:a01321b496c15f4e32891416c7d21418f69be62d @@ -2986,8 +3130,8 @@ trackedFiles: pristine_git_object: 8e7b4cee45b8a8372b2e75a1bec819d420a6ec15 docs/sdks/m2m/README.md: id: f747d3bd08a1 - last_write_checksum: sha1:c2645ba7f6a21d18766fc0308f404e632f9907eb - pristine_git_object: 5c15a18a6205c1840ae2d6535bde2763d88559a7 + last_write_checksum: sha1:b6fb4c63322d31cd53b937e06ba0dda9a23eb77a + pristine_git_object: 728b2c3f76cf8f2a240895afca559744be4e7809 docs/sdks/machines/README.md: id: ab83178bf481 last_write_checksum: sha1:336c9e9051ada8ad871f1f3d53b597e0a073b084 @@ -3010,8 +3154,8 @@ trackedFiles: pristine_git_object: deff9a154201d1ffd78196921c964ce133788bcc docs/sdks/organizationinvitationssdk/README.md: id: a75042d035e8 - last_write_checksum: sha1:746d9bc5b19c6ddea80d8e9359b0d029b11ba8fc - pristine_git_object: 5cd0f7423a28535cd402d5a5dc5da3dbd4f1e004 + last_write_checksum: sha1:5b8d5a65af4dd05e3947662f1af94650ecd0fe4a + pristine_git_object: d28f8db4aad67eed71e83cfbec30366810172245 docs/sdks/organizationmembershipssdk/README.md: id: 71f18c70c58f last_write_checksum: sha1:5bb5e7b3457347a3471c4757e732a76eac751c2c @@ -3026,8 +3170,8 @@ trackedFiles: pristine_git_object: 327f8cee360b2a99686db8635dce0d5b3cfda973 docs/sdks/organizationssdk/README.md: id: bc6106d94add - last_write_checksum: sha1:d8a4dec2414c0557ee0657e9faecec103fa97fdb - pristine_git_object: 1c44d7313dfbc663028bf5c3f1d31b97684ece0e + last_write_checksum: sha1:ae878e4abb7fc4aa465cc5b41eddebe2a92376c6 + pristine_git_object: 1413d7599ceaa2b0e9a04eb55f00a4ed96bdb537 docs/sdks/phonenumbers/README.md: id: bfed92f30c8c last_write_checksum: sha1:525905d8e54c5b500d6cf49a9daa3d7e7be02822 @@ -3050,8 +3194,8 @@ trackedFiles: pristine_git_object: 7d1fc602a2746177156b6c74097369e809db9831 docs/sdks/sessions/README.md: id: 57ad62844f79 - last_write_checksum: sha1:f93ee7be36e052fa7db047cd31a57ef20faf50c6 - pristine_git_object: 5c6e559562c90ba9b20ab5f2b2dcfd9bd3fd3cec + last_write_checksum: sha1:aa90f444d0a8b6efe38e390d7987b634eb07ca9a + pristine_git_object: ce0066d269eb297d294d071a9ebd01845daf7309 docs/sdks/signintokens/README.md: id: 1fc872e39b51 last_write_checksum: sha1:8a1a8f37c37602fd12d930a621a2c8de9015d844 @@ -3070,8 +3214,8 @@ trackedFiles: pristine_git_object: 3b5b06e9e6e00d8c21aa5de0fa5754acec7173d5 docs/sdks/users/README.md: id: 5d80027045fe - last_write_checksum: sha1:d601145dbd7c2f3d1e9389a1ca6eb376b8194224 - pristine_git_object: bb94c38fb227af744cde668eebcc3034cb9772e5 + last_write_checksum: sha1:aa027daa10dd7a9aefb25eb0c67325b23cb4e58e + pristine_git_object: 22d69951bfb9da09f4e88a4b368c8c8044abdbb3 docs/sdks/waitlistentriessdk/README.md: id: be78acbbb2f4 last_write_checksum: sha1:08794f1399c6b81cf83ef513816222cb5d12f53c @@ -3094,8 +3238,8 @@ trackedFiles: pristine_git_object: 7fd8db13ad9399ab075a5fb70e6da17525ad3ed0 pyproject.toml: id: 5d07e7d72637 - last_write_checksum: sha1:0f1debbce14c770ffce4f01714f781fe121d5752 - pristine_git_object: a82198010a259775a7aeef894b40ac46230b8548 + last_write_checksum: sha1:2797a84708e53823b668526b5e2bf5e580b91fa1 + pristine_git_object: 353a2e194bb62c032e75f62bc1d446f0e8e9bd82 scripts/prepare_readme.py: id: e0c5957a6035 last_write_checksum: sha1:419f10ccc385a29136e599315b61a0aa7a1c3e15 @@ -3122,12 +3266,16 @@ trackedFiles: pristine_git_object: 4926429d3dfb2c34589715971acb070ed3756559 src/clerk_backend_api/_version.py: id: 9bcb16a88e08 - last_write_checksum: sha1:fc0e8d234888c733e5b38f2270acba3a1120e547 - pristine_git_object: 967f00ac1041a8c989a5a260e2525bf4f20168fc + last_write_checksum: sha1:caf38a6867c6d63587fa96a26587348fefb3f13f + pristine_git_object: 7336e85a577ebbc556a29b36e72eee754497a6e5 src/clerk_backend_api/actortokens.py: id: 3b3f89863233 last_write_checksum: sha1:b83001f21b2750ff95b82cc953ae588d8468d82a pristine_git_object: b736851584d478610d4d94a3c9690878db20aba1 + src/clerk_backend_api/agenttasks.py: + id: d3c079113f2a + last_write_checksum: sha1:b90b1b412696bf33b90090cea53ac2b13341207c + pristine_git_object: dcf9da19f950a77676ec642a282a5578e38d6f89 src/clerk_backend_api/allowlistidentifiers.py: id: 70ccf975110b last_write_checksum: sha1:a2d5205ee0068d14b702ea9ac2ebb0c28d8c9aa3 @@ -3162,8 +3310,8 @@ trackedFiles: pristine_git_object: a88675dd60d7c7ba6c6e49d6f331f19649f88e30 src/clerk_backend_api/emailaddresses.py: id: 90abfcbd4312 - last_write_checksum: sha1:94828329ca7f4074cffa7ea08223bbf120a277c0 - pristine_git_object: 379f2198f827a5819fd2b4ee7f08f938e6043d06 + last_write_checksum: sha1:5437021eac50506d9190a58f4e14dcf1d17c243b + pristine_git_object: 3eb1181cd1b63e0f23bda504469a36cec57204f4 src/clerk_backend_api/emailandsmstemplates.py: id: 6b0d6ee5c16d last_write_checksum: sha1:5f6a0e91fdc0a38a6c60be0cd5badd97011f1e28 @@ -3178,8 +3326,8 @@ trackedFiles: pristine_git_object: 89560b566073785535643e694c112bedbd3db13d src/clerk_backend_api/instancesettings_sdk.py: id: 1ec41349c1e0 - last_write_checksum: sha1:ac384d76c2186482ffb621f75d2a7d3fd3768095 - pristine_git_object: 9a864e4c3a1823f5c342e05966b85a662359d0a9 + last_write_checksum: sha1:4fe4b7c419c773f0f3939f6b991e6ea4f7d86816 + pristine_git_object: 5c1d11ce92bd5c31b61577aa7cb494969f195492 src/clerk_backend_api/invitations.py: id: 1bc9adec1572 last_write_checksum: sha1:58f6a4371229e13d2c26fc8a0d68c090d10dd034 @@ -3194,8 +3342,8 @@ trackedFiles: pristine_git_object: a6a243424b8bdffdbcbaccc799f543f8539cfdbe src/clerk_backend_api/m2m.py: id: 1f8b7e2b1d90 - last_write_checksum: sha1:50c2b212ae1a60034de06a34b08ec75f6f131b0e - pristine_git_object: 658e691cc6895bbecad0856d5af35ceda0adb91e + last_write_checksum: sha1:031dbf36af37955116686f600772497e79a867bc + pristine_git_object: fd97695227458195a05a7fbb8e53142885c87537 src/clerk_backend_api/machines.py: id: 5fbf914a1578 last_write_checksum: sha1:517366e121e1577b52ce8a07adea251afec5205f @@ -3206,24 +3354,40 @@ trackedFiles: pristine_git_object: e7c169770991082a5066ac02759632e1af71fbb5 src/clerk_backend_api/models/__init__.py: id: 97d9388d85c1 - last_write_checksum: sha1:a2db400bda6377b8f8166bd0ada259300568f1e5 - pristine_git_object: ba48fdf91457b43b08f0d6fed49269c859767f84 + last_write_checksum: sha1:80fae7fea71309635cd45baf53951cd782f34c0c + pristine_git_object: 5f24128e4acc1c23cc23e4a69751028eff0c9f35 src/clerk_backend_api/models/actortoken.py: id: afa1aeb1f89c - last_write_checksum: sha1:e9e2aca724744193c95d120d22dd3ca0c6023b74 - pristine_git_object: 021b2528cdd1771e28a4d303a92830318381d4a6 + last_write_checksum: sha1:f45c3c3a3572607ac2aead2882b3e6de8e3bfdd6 + pristine_git_object: c8a0b7991352cc4caa756b79841070aff82a844a src/clerk_backend_api/models/adddomainop.py: id: bc5a2ca3e43f - last_write_checksum: sha1:0351d47b81ab93d5ce624a71c38e08d671559d7f - pristine_git_object: e6525d6f87959bd7f8bdb2a3c2944b8fba7257bd + last_write_checksum: sha1:41b0c518cfc3cd89259ff06b1ba4224268161dae + pristine_git_object: 85379169b531e09b487fe22f1409b226bad318fa src/clerk_backend_api/models/addrolestorolesetop.py: id: 545dc13fd20c - last_write_checksum: sha1:be77c76b77d3027144482e89ad4e9fedf17fffed - pristine_git_object: 7abbfe2273ac1f742b1a2175a1c21fc6983213d8 + last_write_checksum: sha1:3113ebd50e5100d52c223b07861bb44e86a9fae1 + pristine_git_object: 752b49003156f7729da2c8461b5b5f8643525905 + src/clerk_backend_api/models/adjustcreditbalancerequest.py: + id: c94a8e1e5823 + last_write_checksum: sha1:ff6efa84463b69d32d7368332a1d66a023b51e3a + pristine_git_object: 3518fe06a6dbcb460749fee76a59b73203e6c763 + src/clerk_backend_api/models/adjustorganizationbillingcreditbalanceop.py: + id: 4909cf3714b1 + last_write_checksum: sha1:56e944e58a333e0da28c97f9e54a732189382cb0 + pristine_git_object: 88fcfa946468c99442e36daf50ee39985cddcf88 + src/clerk_backend_api/models/adjustuserbillingcreditbalanceop.py: + id: 083d8d9246cc + last_write_checksum: sha1:7bbbbef2e4232839716181bd028479914ac0f1ef + pristine_git_object: 8278c928681f0e757b7e2867aa91d7856cd4bce3 + src/clerk_backend_api/models/agenttask.py: + id: 625fdb05f08f + last_write_checksum: sha1:760d78781760c0b4b9a6cc65cfb3db8819e7c8f3 + pristine_git_object: 74d2a70557423511e1275d390821229eb6554d60 src/clerk_backend_api/models/allowlistidentifier.py: id: 15fed620f318 - last_write_checksum: sha1:a214d4719e2eb5b8c67f3a93df3a7c5762b9199c - pristine_git_object: 6fb00aa7bafe92d7074371d0536191303ca051e3 + last_write_checksum: sha1:9ab952bdfc6be83c88cef2880d56f37956ceccd9 + pristine_git_object: b30831efa6f0c7f08d4ea14df40f1697cbbfa772 src/clerk_backend_api/models/assignpermissiontoorganizationroleop.py: id: 13b0d15fe2f7 last_write_checksum: sha1:b8518e79f35e9206d341360a617501f89bc4abb9 @@ -3234,88 +3398,112 @@ trackedFiles: pristine_git_object: 391a1f7659fe78a3fd5e5cf2965a2e412ddaa6bd src/clerk_backend_api/models/billingpaymentattempt.py: id: b33ce5ce325b - last_write_checksum: sha1:a549bcf67e003caea266bdd773eee60ec079f262 - pristine_git_object: a55054673b9e2dc47fe918955c6d146e6e1c0bce + last_write_checksum: sha1:11c13dfc38f06c8efa6294ddb3b3fc01c500c813 + pristine_git_object: 4fbd856f15e7bfd4f0a86877576ba228c08dfbdd src/clerk_backend_api/models/billingpriceresponse.py: id: accd55daa3c3 - last_write_checksum: sha1:744a28e7c0fc8559e7bbbd3b2fab8b3e627fcfee - pristine_git_object: d68c5862445206481ea2858fd6bf6e5868edff0f + last_write_checksum: sha1:fac2c6832c0d669ea0e6633bcfb00fa5ba748b20 + pristine_git_object: 6afea9f4309b4cf7963f5eb1ff24f9bdfbee7483 src/clerk_backend_api/models/billingstatement.py: id: ea675089f24e - last_write_checksum: sha1:7fab33b70188999705352543f52b41c8284cdecf - pristine_git_object: 66c0c8acf386fc0a24e02871ce1c34b4bf8d7072 + last_write_checksum: sha1:064cbdb47e72184e486787047a051ffbdd0af2f2 + pristine_git_object: a0cfa52bcf1889af4e30cdad89189ee64a1fbfcb src/clerk_backend_api/models/blocklistidentifier.py: id: 2bc53a82c186 - last_write_checksum: sha1:fe4bdb300b9b42f312e513d24fe49f044704725f - pristine_git_object: 2fa3a59fd159a1f8638b51e09da43719e6ce2d9e + last_write_checksum: sha1:fe56a4f9ed5ddd62c3e4f9396f8ebe567005071c + pristine_git_object: 0865d247bcac70f21d44dd65a9345b7e7ab4dc31 src/clerk_backend_api/models/blocklistidentifiers.py: id: d6356af0312a last_write_checksum: sha1:eaef16b87ad090dcf7a4342e81d112e391c0d545 pristine_git_object: 5984df112340fd0819a9c16e46f592de30402d58 src/clerk_backend_api/models/cancelcommercesubscriptionitemop.py: id: bfd0c484da6a - last_write_checksum: sha1:d75c28821ce5330d6db3fdb0233bf2f5276ca44e - pristine_git_object: 2a1c98fa14852a9f85024ff2042b8a901c37ad37 + last_write_checksum: sha1:0e0575570a1ea594f49e007e005679b62d054111 + pristine_git_object: b6d622d7f48eae21d2c34700d95d84bd58808b75 src/clerk_backend_api/models/changeproductioninstancedomainop.py: id: 60f1daeb920e - last_write_checksum: sha1:0b683e7cab39ac6ec5748641047867b5b90924a0 - pristine_git_object: cbf28f56793ba140de46ea028ed4c0c16502bf23 + last_write_checksum: sha1:9c01c6bbe160c3a02eb9dd86cebd86c7501229dd + pristine_git_object: b6b17b50ecf7de50325e777d637eea2898b6819f src/clerk_backend_api/models/clerkbaseerror.py: id: 0d8b15575e58 last_write_checksum: sha1:3146b0399d0c193e5bd3921292cf003e7ca5b346 pristine_git_object: 39f2e030f980f78c5c0f2ecd8030ce4d493f9ca5 src/clerk_backend_api/models/clerkerror.py: id: 2ccb21dde563 - last_write_checksum: sha1:10c9399458d04820fd944a2d90733ee0512803e2 - pristine_git_object: 064eb40559c037f35296218343a2a5a8d11c00ce + last_write_checksum: sha1:85e4d7b652c239522d472b321e39f5749e121ec8 + pristine_git_object: dd3c123ecc3f6994c7a9b649100e57f689cba3ad src/clerk_backend_api/models/clerkerrors.py: id: 6d281fef4fc7 last_write_checksum: sha1:5aae5b16a119642aa3fef28537f02dc47959e3d8 pristine_git_object: 7658c12b00359d59a39263571e84cf3f2cc18f9b src/clerk_backend_api/models/client.py: id: e9612d07140a - last_write_checksum: sha1:0ee064aa14c1492e2022beacb0c34987763fb5e8 - pristine_git_object: 6b8c03da981b2af854c9ed53aacb0f42060015e1 + last_write_checksum: sha1:550ae5a62ba3d0a68a01b079e09ba14cdeb8f4df + pristine_git_object: 48a5e89054a1c2ada7d8d34a9a3a8d18429de736 src/clerk_backend_api/models/cnametarget.py: id: 19d1a5bcba1e last_write_checksum: sha1:d4857924ba9f8d310369885dfb6ea46ed7625c68 pristine_git_object: befd3e50b7344285eaaa951c9648abe3ca9776af + src/clerk_backend_api/models/commercecreditbalanceresponse.py: + id: 332dbefacad8 + last_write_checksum: sha1:4a1d0f62fde9ec20b744e1ca78a0ca36c96db981 + pristine_git_object: 94bdb51814eafbc2f374b4a2023ac3c2a4fb4a1e + src/clerk_backend_api/models/commercecreditledgerresponse.py: + id: 14d5cfc6c25b + last_write_checksum: sha1:c3265f4135c2dd465b66d9f637f7c0ac6a90b871 + pristine_git_object: 1efd35255eb3a940490f668f9cef5e972b4cdf00 src/clerk_backend_api/models/commercemoneyresponse.py: id: a252a54968d5 last_write_checksum: sha1:2e69dba9bb15c716e7984b1677f4093ad4d08daa pristine_git_object: 0d7410fe43617ba2a0bf8d9c73efc9fe01aa97e7 src/clerk_backend_api/models/commercepayerresponse.py: id: ea12e5a3d074 - last_write_checksum: sha1:02507e6f9ae2c0031d7bee0929631800438857ec - pristine_git_object: 70993e77fc62a2b8faccd2d319862be9ae808ad2 + last_write_checksum: sha1:d6525cee2cbad78bf2af934f1f8fda9ddbb8fa9b + pristine_git_object: 41eb11d7376468c5bbb7617bee90671694cd0e21 src/clerk_backend_api/models/commercepaymentmethodresponse.py: id: cd3467d47354 - last_write_checksum: sha1:0984454db2ef9d48548fc086ef125a309f6c06e2 - pristine_git_object: 0137de4dd0736e452d5e55d7aaca4e851be63048 + last_write_checksum: sha1:1eab18b6412e1fa640377a90010ccca997505f2c + pristine_git_object: ff3d5d6d882d1520b85486f6fd17d946d390a07c + src/clerk_backend_api/models/commerceperunittotal.py: + id: fc515b4cbc8e + last_write_checksum: sha1:08aae15a3b31ea6007b2a849cfe88587a5b98560 + pristine_git_object: 1b55e6cf4d462bc35f06f6ac0e4c9f7d82b7c93c + src/clerk_backend_api/models/commerceperunittotaltier.py: + id: 33232c513703 + last_write_checksum: sha1:67f164dc85b623b13fbb8446d2a80a4efe4952c0 + pristine_git_object: 5a279e4f652f7cc2d9e0b3c387bc27b24bd4d946 src/clerk_backend_api/models/commerceplan.py: id: 865974d0de5a - last_write_checksum: sha1:e55ed99a6363865f50abd0ddd074e8af28a0f0d6 - pristine_git_object: f294f1aa9f5b50eabdf5d9e39a743e6d7ec93743 + last_write_checksum: sha1:f66f7cf7b8d8e102afce310564a4f426a690594c + pristine_git_object: 04437f237f8efa4389698a4355ac270749825a13 + src/clerk_backend_api/models/commerceplanunitprice.py: + id: d835998ef008 + last_write_checksum: sha1:4e4e144d8b5d1cd9f2674f037901a6872a6fb8f4 + pristine_git_object: 341c3c5109119d2fa74373c964940fd73b27b3c4 + src/clerk_backend_api/models/commerceplanunitpricetier.py: + id: 32afc70d21ea + last_write_checksum: sha1:825d25a72b98112a3f149f049fe477aa944925b7 + pristine_git_object: 704f0476ce3e2d43e7ab5ad1776dc6801f2ad1fd src/clerk_backend_api/models/commercepricetransitiondetails.py: id: d28d493401ba - last_write_checksum: sha1:7a43f29bdbb3edcaa0e56f7a55e03427a27703bc - pristine_git_object: c2c049e590d36a3af939340079a9ca8cbf259b35 + last_write_checksum: sha1:1d5e6c75677f9098f667d9ee9706622961139a2f + pristine_git_object: 7b27c7caa8ad3c07e1b93e5946c37988541777f4 src/clerk_backend_api/models/commercepricetransitionresponse.py: id: 1b9a6445ff3e last_write_checksum: sha1:49392cfefbfcf845361689fde2d526738b25e744 pristine_git_object: 1d732f5d551c2939c1695550ce3a3fb39141c4c8 src/clerk_backend_api/models/commercesubscription.py: id: 4be9b36998a4 - last_write_checksum: sha1:d726ae49c6c57815765f8d6d3213da8433e4b41b - pristine_git_object: 56bba50a8bbda8a9df8586d86350feada95fb827 + last_write_checksum: sha1:476a815126ecd2456e1945833a1d73ea8e59e53d + pristine_git_object: 0cedc363bdc3503befdcbe93ad435483ed923334 src/clerk_backend_api/models/commercesubscriptioncreditresponse.py: id: 69454e300fab - last_write_checksum: sha1:e7aa59eacd54727bb8cbd5a96e0b2a1128359c85 - pristine_git_object: 24678d63ef162246f6cc124a15469a26bc8dfb62 + last_write_checksum: sha1:8a1ae45dc0debe6d8b544b03226533aba815fec8 + pristine_git_object: 506a196fbe4a0973d608f60ef3767e740f6f4cf0 src/clerk_backend_api/models/commercesubscriptionitem.py: id: 85ab9baf8dde - last_write_checksum: sha1:e9e629955fdba301198689d1b8beae1bc35b5ad2 - pristine_git_object: 6faf7b563bd673af85db3766984c2c2d1e1ff93f + last_write_checksum: sha1:8c2adfede6fdd9f910146fe35d019c1c2f2ba944 + pristine_git_object: 6d41c6ee21cf9640b6440dcda047d64ad33d068a src/clerk_backend_api/models/commercesubscriptionnextpayment.py: id: 3f0bb47b0862 last_write_checksum: sha1:f071c87365502ce03cac8197aea5a6bb9df21bd2 @@ -3326,20 +3514,24 @@ trackedFiles: pristine_git_object: ba81bc349ab406c3dec241bc3a65de30cfb8a9ff src/clerk_backend_api/models/createactortokenop.py: id: 3671156c7bd7 - last_write_checksum: sha1:38111b4266e127a867fc29e2fd9e759429bc9cb5 - pristine_git_object: 48e296f6785280868ddf584fb43a46c65e67105e + last_write_checksum: sha1:94f8c5799e625dd0fef8831e130108899baea503 + pristine_git_object: 13b4eae2dcf5d1930d8328e8e3cbbd814ada8955 + src/clerk_backend_api/models/createagenttaskop.py: + id: ea75a38c02de + last_write_checksum: sha1:165d3a6bf0460ffa798eebb943dbd34801433fec + pristine_git_object: 7b77eb7a2d1f7f4285e8e0941c70de56a8b6de67 src/clerk_backend_api/models/createallowlistidentifierop.py: id: 85c46051e941 - last_write_checksum: sha1:89e82b6490094d87d5fdcc04d1806efd7d22d353 - pristine_git_object: 6e45fe429166910fb446a80e5af584bc2091386a + last_write_checksum: sha1:82283dcacb19cf376c222777113347a38c0c036d + pristine_git_object: 00f885744e7c9d54e1cfb05224701b49ef0fea8e src/clerk_backend_api/models/createapikeyop.py: id: e8b0987d0c64 - last_write_checksum: sha1:c586fcbe60320365b2b8367acf272637c941cb3e - pristine_git_object: b252ed0d87eb93c5043cd38d11d19a0234a43098 + last_write_checksum: sha1:0ab0cd0e8b20d0786c10a9de563d2064d7b5d313 + pristine_git_object: 37804622d87b5d4dd263c8892289a005457e7bda src/clerk_backend_api/models/createbillingpricerequest.py: id: b97e499e0829 - last_write_checksum: sha1:c092a8293f5665b68c5b9f5a57d8abf176338660 - pristine_git_object: e714399bfa7d60b55ac82eb561b55a789df97392 + last_write_checksum: sha1:283804849eca02e00ccdc6801fd894ae0e68cb2c + pristine_git_object: 245555b45f738e504e766d2c7d4c46486b3b02dc src/clerk_backend_api/models/createbillingpricetransitionop.py: id: b2b936b90df7 last_write_checksum: sha1:6a158d92eb5164cb73cf31b223d2d1a68f0a715f @@ -3350,108 +3542,108 @@ trackedFiles: pristine_git_object: a44d1bc0b579e81a57a65220f5af144ffdc3d94d src/clerk_backend_api/models/createbulkinvitationsop.py: id: 8df99ebd7202 - last_write_checksum: sha1:922b48a042bbae0ba453268a67999aee973eaa03 - pristine_git_object: f75b6d2aab2a3183f94fd70cbd1a8d73eeef3252 + last_write_checksum: sha1:a914704595388e3003d51c429b5c3c205404eb88 + pristine_git_object: f244c646fd1c3f58107e47c76f1db60c6f2e0771 src/clerk_backend_api/models/createbulkwaitlistentriesop.py: id: 5b8b270c6021 - last_write_checksum: sha1:07de644ddfb45cd3e503d7d7a94e05b07ad46d80 - pristine_git_object: 65daf5563dcb57a5c79d8807220945f76cb42e15 + last_write_checksum: sha1:7b1d09608da4ebcdc46e1323f8dbfac1d50d6b1b + pristine_git_object: 8d6b314cd9ee2532a8ced05f4a07587eb9773515 src/clerk_backend_api/models/createemailaddressop.py: id: 02f3665954c0 - last_write_checksum: sha1:3594f421e0a1bed8e3f3bf8ff8815304cdf50a64 - pristine_git_object: 406b8ac4b1d25b3ca6a4bfb060c396ecd8071f50 + last_write_checksum: sha1:c5c16f4de0268469752fb3ae5179124b1495fe51 + pristine_git_object: 34c45a26ae1b0ccbab01e5b176efb909f02d3418 src/clerk_backend_api/models/createinvitationop.py: id: 479deaac075b - last_write_checksum: sha1:d885e45557975ac000b87e68d8bbdfc228dba9cf - pristine_git_object: 21113731c6746ad57892383bdd43e4b75f8942e1 + last_write_checksum: sha1:a108f1ad1f42a813c335e9bcf6abd75fc9851da7 + pristine_git_object: 9bb38efa2854829a85b3d30b46edee8eed461464 src/clerk_backend_api/models/createjwttemplateop.py: id: 4f4d803f2f76 - last_write_checksum: sha1:d9715e77fe6ecd29d13959864ca5450be305862e - pristine_git_object: 52c65fa838a1144d66655408392d48070b27ebef + last_write_checksum: sha1:6b68559ab6503b8cf83cc0e72ba5a6796271dd94 + pristine_git_object: cee81a44a6393b0496faf02acade7bc09006b5ef src/clerk_backend_api/models/createm2mtokenop.py: id: bf590edaf51a - last_write_checksum: sha1:8957868fccb328afe9d671ce762fb5b5abced592 - pristine_git_object: 56c5f2845fa29280db036b0b27834aad6fbe6c0a + last_write_checksum: sha1:62af93acaf706adff494c0047b9931abe4746c55 + pristine_git_object: 3dfa31f72fc33bc1aae44a6797a7bbd3b4cb42be src/clerk_backend_api/models/createmachineop.py: id: e9e4c3a0de8b - last_write_checksum: sha1:fb83e570ca829619733a69cd3ed1a7795ea4bbd2 - pristine_git_object: 3b4d5887b0108b94e38ebcb5ef4b3ee77020342f + last_write_checksum: sha1:7e8dee83a2596daeef590e4febdb8c7a4e681b28 + pristine_git_object: 67a688e41c55f48a5b411a2dc4eef82bb8c78998 src/clerk_backend_api/models/createmachinescopeop.py: id: e3ab996637b6 - last_write_checksum: sha1:8d58f48a1bfd0d0a5e74b6436949e36158762f02 - pristine_git_object: 037fddfe790154334edd567a2ca635646175656c + last_write_checksum: sha1:79dca39bc67b2c1443168b5286119b259233a902 + pristine_git_object: 48c4cf13f58f6b018f3de395211b4b4098896186 src/clerk_backend_api/models/createoauthapplicationop.py: id: 7793e4c722dc - last_write_checksum: sha1:ba29f776ec1347b592c2aa3e75e8ab17c2ce9b47 - pristine_git_object: a1be54e0bb748be0cf03df2d423831514fa813d2 + last_write_checksum: sha1:b9e32c428a417782141ec02da7d61553653ff2aa + pristine_git_object: ecde431dd1e9d5ea8585905d15d8f8b8fe1704f2 src/clerk_backend_api/models/createorganizationdomainop.py: id: 5a6ae0dba9f8 - last_write_checksum: sha1:fc53fb776682124acc5f5eb072568f0907a33f5d - pristine_git_object: a31ae200991f8bc9422ec27c2af7536486ae2c82 + last_write_checksum: sha1:1788fded50a6c2ba3d715e6a5fcfd740ba49a039 + pristine_git_object: 572415433882a5e6f3b5518d455f92b5a23e4c5c src/clerk_backend_api/models/createorganizationinvitationbulkop.py: id: ac16d568c0ae - last_write_checksum: sha1:a525428f2e9273a5917a6c9c501c201248f4e0c7 - pristine_git_object: 2c9e5224fec5f84a3f4071d4cc4f893e71508df8 + last_write_checksum: sha1:e1759e1e36086a018500b46287897415c78b38b2 + pristine_git_object: b402a8e4515a1cca8fb896cda93f77e7e3c6fb04 src/clerk_backend_api/models/createorganizationinvitationop.py: id: dd0c39ef272b - last_write_checksum: sha1:28a413ca67ba3adaa7290740eaaef8c0551fd232 - pristine_git_object: 2df11af4b820620b79fa48cc985c5cf02a52fd69 + last_write_checksum: sha1:aab5912be99b6dd2f0eaca4170e479211e9ac907 + pristine_git_object: b51d910f37a8ea7570ba2d60a7dbf0f01a39de02 src/clerk_backend_api/models/createorganizationmembershipop.py: id: 9317fd55a7f5 - last_write_checksum: sha1:e959a2f8318937c2c2ec82f2239499ff78eaabd7 - pristine_git_object: 166ea01e6abdbb9d0bb1ba5272f6e8e501283d76 + last_write_checksum: sha1:6a46c22e6707e6588f13fea1a6d21e9aba8cf190 + pristine_git_object: a008cc2de5e741dcc8a61f350221dc25b34c1aa1 src/clerk_backend_api/models/createorganizationop.py: id: 89ac4d7f3bc7 - last_write_checksum: sha1:5ee655bd5aeb9714410008453f6323cf6971933e - pristine_git_object: 5e9477d1fc3c48cf5e35bb0125c0dbbe26b23173 + last_write_checksum: sha1:31fb05ee6e6d593a6e40ba2573cd411bd82a4a5e + pristine_git_object: 3f3503ee83d0974f7a872fed6fe4446c9865dd38 src/clerk_backend_api/models/createorganizationpermissionop.py: id: d0fb937e2919 - last_write_checksum: sha1:972e1f34290e02c5d12adc703797ccaabf84c056 - pristine_git_object: 06af93cc8f98623ba75fadd853583c04f4766651 + last_write_checksum: sha1:078683b3571b69531194fb73c09c790ac2094e25 + pristine_git_object: 991668014d8b89b17e69e7cf2b7b8a1587d58f27 src/clerk_backend_api/models/createorganizationroleop.py: id: ccc477e150c5 - last_write_checksum: sha1:e59e66c37fe5e711649eecda17f7a688dfdc71fc - pristine_git_object: 2af8899a17c7994d77ac137d9e1a11abb87675d0 + last_write_checksum: sha1:704181ed870aac0426f558442dbe0dd4c48bf533 + pristine_git_object: e8787a675215253721269a4eda71ab20bb5f8dc4 src/clerk_backend_api/models/createphonenumberop.py: id: 68d1b792d95f - last_write_checksum: sha1:b4aa4446482e89962128861584c85c1a68a42367 - pristine_git_object: 296b1e547f6750a6c5b05ee058efaa9c4f89ab6c + last_write_checksum: sha1:0c764e59122d0b5a310320a0b143e3fed20473d1 + pristine_git_object: 7c35b66fc0a84a6226289f16b80322bfcce8c760 src/clerk_backend_api/models/createredirecturlop.py: id: 400a59edf754 last_write_checksum: sha1:b3cdf8c65fa446e852c6ef4a07077e2bdb331473 pristine_git_object: 843efb887f6ef1fdc69197b58e5a8df022eae78e src/clerk_backend_api/models/createrolesetop.py: id: e2449a1faf79 - last_write_checksum: sha1:76d04d1d9fd5c6f504fce950dee1cba7c532ea3e - pristine_git_object: 8ceabfc2d3b1490c07f6af7db2362f85d6ad2280 + last_write_checksum: sha1:463138e263eab471ec56db8ac68f9c4c1ec55ba8 + pristine_git_object: 0f7ad3419a100eed4842cefeb384212f69965898 src/clerk_backend_api/models/createsamlconnectionop.py: id: 5e58a895eb84 - last_write_checksum: sha1:7b9131cf50d3f546fe91585d440de288a760353c - pristine_git_object: ba9400896431662b0b2f36daa443add9f8d77480 + last_write_checksum: sha1:ae8652b0a24dc873631420a6488a72137e95c55c + pristine_git_object: b9f43a36f173a28596a31468e5ce7807a605ea82 src/clerk_backend_api/models/createsessionop.py: id: 0e1e77977e4a - last_write_checksum: sha1:2a2ee6afdbf518656ebe96e46194c3db40168f0e - pristine_git_object: f89e69a5d51ebab9973c8c01ce9c23d19fedd1b9 + last_write_checksum: sha1:15a73bd220b8bc790cc8c07ac2e05fbeaade792b + pristine_git_object: e1515d741f2824da7780311477ab0b37c7b7a445 src/clerk_backend_api/models/createsessiontokenfromtemplateop.py: id: 89dc4d320b91 - last_write_checksum: sha1:150ce79fe3c5a7afab3d6a2ae0710e45899d5e6c - pristine_git_object: 7f5a807ded2e0700e42e2cf6f13d3f35d722421f + last_write_checksum: sha1:e10c43c4c743ff682cf5835a30c7880d8d1ddc53 + pristine_git_object: 7c91c3ffe60ca88c8a03ffe7849c165bf185e551 src/clerk_backend_api/models/createsessiontokenop.py: id: 7c6bb6912d1f - last_write_checksum: sha1:23be6f9d45c620dcfd0acf0c8ca1e86c98a45ff3 - pristine_git_object: 20e94f2db8fd21f31d5ec833d6fe614114e52c39 + last_write_checksum: sha1:92b8bf57c3557fb89d0dc0cf56b8a1c2fefb7c7d + pristine_git_object: acf76e59ac9bed1679665ccc90a4fd86dbc918fc src/clerk_backend_api/models/createsignintokenop.py: id: 1cf7c182ff64 - last_write_checksum: sha1:1385aa3a66d610ae814ba87bcc6202a547050358 - pristine_git_object: b665cfde30aa80a9649e894b82fb3b3c2049fadc + last_write_checksum: sha1:132c500e7f5514fea25d236f8b2b48d95bd48948 + pristine_git_object: 162d767c263b8d90de3f60d1991f12261cf70079 src/clerk_backend_api/models/createuserop.py: id: bacf02afe019 - last_write_checksum: sha1:bb161ad610780e39e4712de8fd433ae830494464 - pristine_git_object: f205ba78a289c9b81169f372c5f4df06dc4a8bae + last_write_checksum: sha1:43772050d71cf73050db958a5c653e416e76bfaa + pristine_git_object: e2a2741002e5ca393abc4367a09654b9d09d6c6c src/clerk_backend_api/models/createwaitlistentryop.py: id: 5fc8451ee608 - last_write_checksum: sha1:75fc9969e85ec9e764cac4818196a21add634290 - pristine_git_object: e84a44eccd40273d15f5637524053d39e520982c + last_write_checksum: sha1:9c93e68fffa5039690697f323c3c50422036c6be + pristine_git_object: 9ffca52573be36e4859811e736dbe72414d55724 src/clerk_backend_api/models/deleteallowlistidentifierop.py: id: 73ba7ed9b357 last_write_checksum: sha1:bbcca230c62f1ad361a9cdcc82c6279a39f6702c @@ -3462,16 +3654,16 @@ trackedFiles: pristine_git_object: 32c9f2f493ad058a93da27c349568c9347ff9ab1 src/clerk_backend_api/models/deletebackupcodeop.py: id: 115b2a3888c7 - last_write_checksum: sha1:e9f81f6b74cbf0cb61d37b39061f7ff3638e2173 - pristine_git_object: 2565eb343b9e5a8617ba1d1cb836461b145a0cc7 + last_write_checksum: sha1:4990e97c20353879808239ee7413784995181c6c + pristine_git_object: 1b539c087211c0931c1815fe8465af5cdf1ccf65 src/clerk_backend_api/models/deleteblocklistidentifierop.py: id: 39d8cc22dddb last_write_checksum: sha1:c8a30974fd0eab88e1b41cbbeae972ff79d90fb1 pristine_git_object: 2138876235da0f11f37c715ecfbd64cb7896da61 src/clerk_backend_api/models/deletedobject.py: id: 90b1fa37a045 - last_write_checksum: sha1:8e481510e264ca2b420046d970c6b12989315938 - pristine_git_object: b877d03ba91fa7730004ba7c6ffc9e50208ea565 + last_write_checksum: sha1:5da771c71b6ed12d71374aa7b0867910573a9945 + pristine_git_object: b8d6c65b10f2cda2e1717e901ae9059cd393d8d3 src/clerk_backend_api/models/deletedomainop.py: id: 951c91a9dcfa last_write_checksum: sha1:9f99b2361f1026123e56ebe080728469b418af0b @@ -3538,8 +3730,8 @@ trackedFiles: pristine_git_object: 3e5cfb25e270dde4e82a59ac4f98b8abfd6de94c src/clerk_backend_api/models/deletetotpop.py: id: 92ed611f8ded - last_write_checksum: sha1:d4f0149835ec24d1c146c45fc23ba78a05eab28e - pristine_git_object: 0115c3e786173455e83c368706a537e6913c2326 + last_write_checksum: sha1:05159ad49569dd49890168766e34f1cb81c96008 + pristine_git_object: 9591d87ca679ebc5b431321cad09c7bc5fb060d1 src/clerk_backend_api/models/deleteuserop.py: id: 7eb66fa68c36 last_write_checksum: sha1:d461b69b3595938a40328108b3fbdb4922cdefe3 @@ -3554,24 +3746,24 @@ trackedFiles: pristine_git_object: cbf0b3e45f9332bcdad6632d947355dea7601bf0 src/clerk_backend_api/models/disablemfaop.py: id: ed94d0f68953 - last_write_checksum: sha1:d41d39c061c5f039b85782ad4a3d93a6e006975a - pristine_git_object: fdbf22133149d5739efb3cb2e76de54e868057bc + last_write_checksum: sha1:b5cf9e6a7a9cf82bf8689223af9e2fa47cf6549c + pristine_git_object: 6cd29d9a285190feb32e652d9cb3b1c728d323a8 src/clerk_backend_api/models/domain.py: id: 733ede72ac6c - last_write_checksum: sha1:d9c53ef781470a067e37e941c2f7b176005b590c - pristine_git_object: 45080d0ce570a5cebf72c50d0e8fd2dfb5884d8a + last_write_checksum: sha1:0e8b83e4020bc27a8c14c93c03f21e4ece64d585 + pristine_git_object: c297fb6ca42e0a491d90286519199d685a87347a src/clerk_backend_api/models/domains.py: id: 795c60265a74 last_write_checksum: sha1:119a83d8f328e5f686682f78705aedbd001e3973 pristine_git_object: 7c2cb9ffb835a0b7605b399091244417ff938c8f src/clerk_backend_api/models/emailaddress.py: id: 29df9abd37d1 - last_write_checksum: sha1:edd1db7ed164152f0c574b2eeb25172faf2dddb9 - pristine_git_object: ebc2650584feb32ce1d12439a8f02fa328185bf4 + last_write_checksum: sha1:6a000327d6c38c9d5fbd264887f29f8f4809ea71 + pristine_git_object: cedaf50969d6011c3c2122b590d398fe898db2b1 src/clerk_backend_api/models/enterpriseaccount.py: id: 76fc27f00649 - last_write_checksum: sha1:035ba999375b4727207012f1dac2cd8ba0ad633f - pristine_git_object: 2582c3c2b803544d1ce220f2ae4e8331a9cea7f1 + last_write_checksum: sha1:87eb961c9cfad9df6d677e10a9a974465dc7beca + pristine_git_object: 66acb9a5008a668a3bde47f82279b8ae079c535b src/clerk_backend_api/models/extendbillingsubscriptionitemfreetrialop.py: id: 5237ca04a999 last_write_checksum: sha1:e2d1bcf81ee76913824f63d6cc8339f734d0ee77 @@ -3582,56 +3774,56 @@ trackedFiles: pristine_git_object: e2bb51e244cd1a26f729b8224cdcd11164a507d1 src/clerk_backend_api/models/externalaccountwithverification.py: id: 79931be73b92 - last_write_checksum: sha1:0ecb50aec577bdaeb574407d71b412586ffd0d18 - pristine_git_object: af4c678b892f7d482faaf513f7934ab5ed11677d + last_write_checksum: sha1:895f169eed0794c53b5cf188a4ca0920e4e33acf + pristine_git_object: a00240cece35d39f60e0e3dd3aa3d97b7030df63 src/clerk_backend_api/models/featureresponse.py: id: 40a15826a18c - last_write_checksum: sha1:ff6de9741c8bdf627203780d9dd4a105df44b21d - pristine_git_object: 0843f3e3020df249f7e7f059787502ff0509cbf8 + last_write_checksum: sha1:84f8316b07acef97d9fd656c26de1f8412a1db1a + pristine_git_object: 4e3156b2accb87165022bfda272b213d49b5d5e3 src/clerk_backend_api/models/getapikeyop.py: id: f596ae838d7a - last_write_checksum: sha1:22805f2c0ba6bdfaac98f76ddc740370d648cc6a - pristine_git_object: 25db1110a66628a31eed00614f4b44e210092b65 + last_write_checksum: sha1:9876d31b54606baad87bf445e4cc3a4fa57b61ae + pristine_git_object: f493b4e681e7b4bc5111cb331d279ed55efc15f1 src/clerk_backend_api/models/getapikeysecretop.py: id: 242e8a4bec54 last_write_checksum: sha1:aad8b46b7d592758b278b50b15a1b5c2c3d53e18 pristine_git_object: 8ebaa17b22d4e6addbfed84d8f721e3745ec214c src/clerk_backend_api/models/getapikeysop.py: id: fd43908c92e8 - last_write_checksum: sha1:2254b4bb132869c58dac33ac5dcd3d5f448028fd - pristine_git_object: e96843c722036e4d86228fdd3ac897f8ab6b1f0d + last_write_checksum: sha1:544c613b1d8cae0f71e616bcb1aec1e830b28029 + pristine_git_object: 30f6d11fec3c5664611556dbb875fba0c62bb911 src/clerk_backend_api/models/getbillingpricelistop.py: id: 5e15d2916c39 - last_write_checksum: sha1:bc8705f5ec9569abfe921c52b7cc981a0f4c76d2 - pristine_git_object: 50d62dfb5fdb17ed856eb3ed1a4b4b242828b7fa + last_write_checksum: sha1:a7adaad4721372e75ca2f383ec70746557c48f3d + pristine_git_object: e36a1d297c9e5d9fae31c485c8d7ca68e60ab964 src/clerk_backend_api/models/getbillingstatementlistop.py: id: 4516da6ba76a - last_write_checksum: sha1:bd0b202bd6e42c9d8a6d6d89ecf3b48067d2abb5 - pristine_git_object: 00de5ed178efae34d84646a3f6c2ea25c7dbedd0 + last_write_checksum: sha1:ca806d8a6788964f55dc4b740a55c76a276fd617 + pristine_git_object: 6cb8ea3a372496d577557a50d3d3ade44391dacc src/clerk_backend_api/models/getbillingstatementop.py: id: bdafa2761db5 last_write_checksum: sha1:e60c8a1382ba806e386e3b642f11f26bd544c080 pristine_git_object: c9a72d95aca03c210c6fe9ed503dd528eea6cc34 src/clerk_backend_api/models/getbillingstatementpaymentattemptsop.py: id: d81889dd5fea - last_write_checksum: sha1:023e72443dd12fb2074baa1fd32296fe5a3ca682 - pristine_git_object: 030342fce198fbe01a12232a44a2df1bf4a76605 + last_write_checksum: sha1:84a03e97b78d64ae93b44b812d93061fabf633cc + pristine_git_object: 31fa51e56c8275db1511b00e65b132071a611897 src/clerk_backend_api/models/getclientlistop.py: id: 145d0beed4e0 - last_write_checksum: sha1:2eaa0572e7eb0c71125534e6abac8191265062f3 - pristine_git_object: dccb9264c3f460d1b2376e9070f355b79584e568 + last_write_checksum: sha1:057147010798b4765bde5c8a5538a1fd05158cc4 + pristine_git_object: 187471b06ae403fed6c1fa21b37b82a3df84c881 src/clerk_backend_api/models/getclientop.py: id: afa544cc607c last_write_checksum: sha1:d0ce16a26eba8ac938ea86da0c69a32613ff2f86 pristine_git_object: 240db31a7cbd0d9df5577d22cbf778b29b409914 src/clerk_backend_api/models/getcommerceplanlistop.py: id: b6e17d45eb11 - last_write_checksum: sha1:bb6349630569ca053c5e78ed2fe705e514d6ca29 - pristine_git_object: 26ca109621ab6f158274794598f0c3b12b60a2ff + last_write_checksum: sha1:73e98573173499b4d84b3c463790d24deeef57c1 + pristine_git_object: f8f0c45fabaa0cf2ab78b223228c74395c9347e2 src/clerk_backend_api/models/getcommercesubscriptionitemlistop.py: id: 1c815aafbef4 - last_write_checksum: sha1:ee2b324aad382a99c1508962b6ba5e1b12a0f424 - pristine_git_object: fa30888efc628c454774a4fc5f45db4a70b14bb6 + last_write_checksum: sha1:43bdf5f3672bdab1f8a8fcce082d22d9659367ff + pristine_git_object: 0541196bcb7274007355c96a9da8798c16cc4390 src/clerk_backend_api/models/getemailaddressop.py: id: 5643cd0c77d6 last_write_checksum: sha1:0142c1c61e447ed1ed80cc5ac5c818ff054e563f @@ -3642,8 +3834,8 @@ trackedFiles: pristine_git_object: 750a3bb04d477022abe913513c1a29e2c913c31f src/clerk_backend_api/models/getm2mtokensop.py: id: dc3c52a4d58a - last_write_checksum: sha1:0bd3fd07eb97a7a0cba85c90e7037581bb42496e - pristine_git_object: b8f3d7c89fa4f8c45985cc783ff86044283aa9ec + last_write_checksum: sha1:3e93ae6c18f733c58e03c7670036829099d0882b + pristine_git_object: 27f9b2795ca11717ea9ca1eaf2dab5c417b63257 src/clerk_backend_api/models/getmachineop.py: id: ad1202eb5323 last_write_checksum: sha1:47ae0d0164103633888a9a090a4cc517e6b9664b @@ -3654,12 +3846,16 @@ trackedFiles: pristine_git_object: 3487ba5842e7a0f5081c1a4bfe03146e11d43211 src/clerk_backend_api/models/getoauthaccesstokenop.py: id: b582eb4aff9c - last_write_checksum: sha1:4741c79db0ca5c3b5ae79812d482d884d55b14bd - pristine_git_object: 7d841693ece87b829effb2d30cc5a45bbb4d2785 + last_write_checksum: sha1:53153432bae5cab6a1140dd531dbc1ee6f2cf0f5 + pristine_git_object: 90c01836b346103a3b7c410bb9e40bc7d7336421 src/clerk_backend_api/models/getoauthapplicationop.py: id: 522d6b0c6049 last_write_checksum: sha1:77ff0eda412b8837b3423eea2d6d5c60a79f7264 pristine_git_object: d75ba4860aed19f57aa1897d86a8a6f116109a7e + src/clerk_backend_api/models/getorganizationbillingcreditbalanceop.py: + id: c1da34c93ada + last_write_checksum: sha1:ef3cda9dd453ed56f5c39a7298df609cacc7361c + pristine_git_object: 047c5f8a188936172669c69cd0bf78da9cf142a1 src/clerk_backend_api/models/getorganizationbillingsubscriptionop.py: id: b332b4137a58 last_write_checksum: sha1:e08261121eb81011cbdc9942b55aef20af8cfc80 @@ -3670,8 +3866,8 @@ trackedFiles: pristine_git_object: 49417ec6ce49f18d3d6752284f3aff0cef7d326a src/clerk_backend_api/models/getorganizationop.py: id: 8c9ddef7aa88 - last_write_checksum: sha1:00ad1fd7de4fce0501b1a4aa9797591f48ef6749 - pristine_git_object: 89708f86ac94ae7a244f0704f65cf78b3ecb2a13 + last_write_checksum: sha1:bd6c272fc8f80b4b36194025f6e22674ff7c127d + pristine_git_object: 1c7ba071aa49899bf541c5a045d25e7c330bdd7f src/clerk_backend_api/models/getorganizationpermissionop.py: id: 8811fdd05b05 last_write_checksum: sha1:086c21817fff0219db9e60f0a33e7759c82c9c3e @@ -3686,8 +3882,8 @@ trackedFiles: pristine_git_object: 464557c4143ca3790f432caa725396ddd40be5a8 src/clerk_backend_api/models/getpublicinterstitialop.py: id: 8416966f0b0e - last_write_checksum: sha1:b88bf40e2bc8d710c9c8cd7343a7dd25c33a28e3 - pristine_git_object: bbe1fc0101efaec6a3ac5963fadafe6c5245fa8b + last_write_checksum: sha1:720b47a40826a320c6f7c9b7dc63268abea95e3d + pristine_git_object: 7946ff2c693db9e7e96d90859ef0367396619d64 src/clerk_backend_api/models/getredirecturlop.py: id: 6057b648df2e last_write_checksum: sha1:d41a1018d05871e7454d474efd95f8190bac67ff @@ -3702,8 +3898,8 @@ trackedFiles: pristine_git_object: 6453dd527a582d4511dac931af76cae1ceb52b83 src/clerk_backend_api/models/getsessionlistop.py: id: a8e161eebd23 - last_write_checksum: sha1:b886e2805fd79d02ba7494b2d91c2e31ae26a11d - pristine_git_object: 7c072fed7465f95bf3fc59e8425f40b6fba5f786 + last_write_checksum: sha1:6e713f4c224f8cc57888f63311eff9000063c44d + pristine_git_object: 623b3439cfa08da48d9085466d466653de06a88a src/clerk_backend_api/models/getsessionop.py: id: 7ff3010b061f last_write_checksum: sha1:534bedf0798c4936bbb3d8e90927a5a888e0242f @@ -3714,40 +3910,44 @@ trackedFiles: pristine_git_object: 87010a40937328e66717d8e4e42e9cec4e4c743f src/clerk_backend_api/models/gettemplatelistop.py: id: c70ee7db9ccf - last_write_checksum: sha1:92be86d2328c20f5d7c03093f0bcd3750b3f3ada - pristine_git_object: 22b0b5262a3928b2d9ce2def81ed8d829655949b + last_write_checksum: sha1:65be9515f9ef02023e2d78685a0612b0deb8e900 + pristine_git_object: 876917c886f53b576414df6100a9fa4308f40664 src/clerk_backend_api/models/gettemplateop.py: id: 9bf7d1b9f2ed last_write_checksum: sha1:e3f8fc7b3bc6c3f587c8c4db4507b98c7962b68d pristine_git_object: 4f5ece72ad536c13e41c232edc2b7c9a195f5bbf + src/clerk_backend_api/models/getuserbillingcreditbalanceop.py: + id: 941757259d44 + last_write_checksum: sha1:d3ecf47d356a64550fbcab372eb5ba22fa25a309 + pristine_git_object: 61868473ecfcca81737cd015f903a39bac0b3610 src/clerk_backend_api/models/getuserbillingsubscriptionop.py: id: 9f40cfd53f76 last_write_checksum: sha1:93d11ba9e0fab7840f95462e0a24638003d60be3 pristine_git_object: 638943c11b73d6256eb3d68156c656b13f3cf9e4 src/clerk_backend_api/models/getuserlistop.py: id: af0fef8affd9 - last_write_checksum: sha1:7f70874907115f5c3dd622b58ccac92a6d52ba4e - pristine_git_object: b8e5330a59715840a22852ca68f7c06373a56712 + last_write_checksum: sha1:45027f3da2aa7c0ed1e6e5798ceb9cd6c7bf5460 + pristine_git_object: 2b0d041562ae48eeedf43ffca36bcd795b183e9e src/clerk_backend_api/models/getuserop.py: id: 1c2e85a07888 last_write_checksum: sha1:1b2e0ea568ee02fb2d04e9c53cbf6f1134b11737 pristine_git_object: 1ed5820e08575f16eb7a5272998e28b3f737777a src/clerk_backend_api/models/getuserscountop.py: id: 5c7fad7c1bda - last_write_checksum: sha1:afef37336c684e2293d58893e233339d0b57d89f - pristine_git_object: 5d3f9cbbb701704d443e70dc4ca7a14019a87064 + last_write_checksum: sha1:fa774f79980109870e30eb44c956dcb57e1b79bd + pristine_git_object: 7f6697d6ac508331e6184eea3c2227308d689d24 src/clerk_backend_api/models/identificationlink.py: id: 16fdc79490bf last_write_checksum: sha1:cf723c84102db05ab1cd4cc1ff89eec9c131ffb4 pristine_git_object: 97b8c1cf2914963db67be95732598224a89fc170 src/clerk_backend_api/models/instance.py: id: 05a213628ace - last_write_checksum: sha1:a88b66af8dc89634a47328eccd2585e7e2a9935e - pristine_git_object: ca9f477638c63df68ceb9991005b43abbcaf05bf + last_write_checksum: sha1:4a673a41ee49e74cc47fea50426739cfb655727b + pristine_git_object: 4da77064c31cf6eb12b18baf63509b789da909c7 src/clerk_backend_api/models/instancegetorganizationmembershipsop.py: id: 952034840b81 - last_write_checksum: sha1:a4e459078553ee8e1194198720b3bcad8eb8246d - pristine_git_object: 348c617efbd855d5dfc77894884b10711622774d + last_write_checksum: sha1:087f136f6b638e929166c6a599552a9876e610df + pristine_git_object: 550fe3d2d383186929b9a20ff1cc64e30b547b44 src/clerk_backend_api/models/instanceprotect.py: id: 64baaf6e2fd8 last_write_checksum: sha1:20b717eada7161c3c894f1ef42f030fe28603f4c @@ -3758,112 +3958,112 @@ trackedFiles: pristine_git_object: ddd0ac692efc93c02a2a8832223f67d66c341721 src/clerk_backend_api/models/instancesettings.py: id: 813025971cc0 - last_write_checksum: sha1:a6d6e461cc12092b1822b150642525301bad2421 - pristine_git_object: 17df4caff99765c44ba0d108c501bf0a42078c0d + last_write_checksum: sha1:e21303d77e24846b9791a1fb4824eb9e2de85d16 + pristine_git_object: 58011ea9f80a8ee9b3c46226a1c8f0a3f703f8e1 src/clerk_backend_api/models/invitation.py: id: b1c4904661ef - last_write_checksum: sha1:ec881fd93089e3d5b8c955d4eeb6e5d4ac183c95 - pristine_git_object: fce619856838b33e2a574c7cdf84749e69488be3 + last_write_checksum: sha1:f29f230562510fd420155ed245cba7637b577953 + pristine_git_object: 82d0870b30b8d2f17b0c99124de9e8ff9be92d01 src/clerk_backend_api/models/invitation_revoked.py: id: 0b42ed7d21d7 - last_write_checksum: sha1:395506a4ec1a78d6f7c0c8ec6d6e229ed17bd698 - pristine_git_object: de7e1b09a13006f790151c680404db57907a979d + last_write_checksum: sha1:3b1b3401824ccbec8d6163329a4baa1f7778988a + pristine_git_object: 8bf1cdfe97dde684ac27814b88307d28c3fe180f src/clerk_backend_api/models/invitewaitlistentryop.py: id: 4202a11988ad - last_write_checksum: sha1:ade722ffc1852f6540520ecb129c0b7ed890aae2 - pristine_git_object: 3fe14c1c6e115ff8951620200734c4f84f5afe42 + last_write_checksum: sha1:07dd29d6be2d3ab58a529a87c4c271716496bd78 + pristine_git_object: adbd32bd533a169b23ed0aafbeecb0fa37ff1ed6 src/clerk_backend_api/models/jwks.py: id: 40438f9ab22a - last_write_checksum: sha1:c16ff243cf885bdfbc56919617d6e5e4ea52f182 - pristine_git_object: 6e5a40710dcc446aea50220475d5c50dfd83fa4e + last_write_checksum: sha1:06e8192bfa1d76ac5ca895341b0253bc7de5cff9 + pristine_git_object: 144c897761933a06d1a3d73e9be6b04aaf301155 src/clerk_backend_api/models/jwttemplate.py: id: d44b9c6fbfd4 last_write_checksum: sha1:63c2e76368c5c414929da2da1ef3cc38b5e3a33f pristine_git_object: 2e30edd845289e450f5278f71491b5a890080aa1 src/clerk_backend_api/models/listallorganizationdomainsop.py: id: "199866500078" - last_write_checksum: sha1:2e238ceab4ef07ee32eaf028ff98e3aee99b3621 - pristine_git_object: 516092efc435e3f1e2ff47fbdbb134d72f8a0bbc + last_write_checksum: sha1:ede3d4d15511cc99414da5bbe6e0bf226ad380ff + pristine_git_object: 8b28daa990d6b1eab9b48ab15be290ab61b8a0a6 src/clerk_backend_api/models/listallowlistidentifiersop.py: id: 44ca21651421 - last_write_checksum: sha1:c56f58469ab0175b300e8397211fc41426fc0150 - pristine_git_object: ee8bb68171d4a1e20f28d82ab91f979a969c9db8 + last_write_checksum: sha1:4cec79f95de73339984720d7dbbd2e8016dfbfff + pristine_git_object: 6cd1131293610a59922aadc98e3e92f4e3ff80fc src/clerk_backend_api/models/listinstanceorganizationinvitationsop.py: id: 2e259aad6454 - last_write_checksum: sha1:dce99b820bc5eed5f2bd135a64c1d40c1c8f0cb9 - pristine_git_object: 921c92e822cd4bbf362d7cbfe4b0893faf42c0a0 + last_write_checksum: sha1:7e9d4ffb2df9b62b57e88059343586c87c6ad247 + pristine_git_object: 6bcb536679901303333841d2fa6042b55c8b733c src/clerk_backend_api/models/listinvitationsop.py: id: 1fc58cd23dcb - last_write_checksum: sha1:00dbe9139fc09c734d83203f2383506d4c4b26d4 - pristine_git_object: c4e6786de5361185fa4b9440cd3aa02cf9202234 + last_write_checksum: sha1:1a5ed09fa96f5d5fcc46cee3eaa04aac2bb49217 + pristine_git_object: 1d51cccf85e0c59efa3850bf9b6b089432a3cf9d src/clerk_backend_api/models/listjwttemplatesop.py: id: 12b88b42285c - last_write_checksum: sha1:8bf86a7aff2098a80ceb41e6b29ec9f6394c4ea7 - pristine_git_object: 71c57a803418b696dd505371a205e2eb05f849d0 + last_write_checksum: sha1:3d9d3092b5e51d106a84f4299d37fb46961e9c25 + pristine_git_object: ab0711aafca217fb5a88217aaa31a4dfe3b577c5 src/clerk_backend_api/models/listmachinesop.py: id: 70e1f6b4fa6e - last_write_checksum: sha1:6b2c7d151e99bcf87488c9f71f4718e9805dd85c - pristine_git_object: ce0a318925251bdf2e0752277b5b24b0350fe641 + last_write_checksum: sha1:e0dc4ef846331fc77db0be84a9555cc2dc1d1a8c + pristine_git_object: 0593f8aa03426823aea3f6257e36ae5fe6c5f123 src/clerk_backend_api/models/listoauthapplicationsop.py: id: aed7918b5db5 - last_write_checksum: sha1:bb2f5842047b3872d660478ff1ca2e74eb0f2334 - pristine_git_object: 86ab8f49a16913c93da890b79841f70aff01aca3 + last_write_checksum: sha1:911223bbf2b5b1fa794093d306a52fbf6884edd8 + pristine_git_object: 2e0a53d0dbba346dbe198c3b62aa991229ebcfef src/clerk_backend_api/models/listorganizationdomainsop.py: id: 189f8d296b8c - last_write_checksum: sha1:8396e366ad2d570217ebd661f94065593f2a578a - pristine_git_object: 74aec04d3967e32dc8c146d851ff7407bbf3527e + last_write_checksum: sha1:1a2610c7ef181dbd2d673fb2a8c2bd71851f9e94 + pristine_git_object: 620c8bf3d0716a45e4887fbb8f97532691467d3a src/clerk_backend_api/models/listorganizationinvitationsop.py: id: d7dfd455485d - last_write_checksum: sha1:a4b799b50c7311ff56b90523dfa5a77dc1cff955 - pristine_git_object: 2ac1a0f9ea3914d98523eafa31515952e4946d63 + last_write_checksum: sha1:0deaf695f830146f0d7cfc89aa75be7a9b000a61 + pristine_git_object: da50becd40b641558106a8fbfd385c978f24ada5 src/clerk_backend_api/models/listorganizationmembershipsop.py: id: 8b694753dd8b - last_write_checksum: sha1:48798abc710647ba7e9f4e20c0387b391df6b92c - pristine_git_object: 216a09f9b55785c7db7122cddf5688315e1e66d8 + last_write_checksum: sha1:b9873ec51c9ab4268a2b43b7a91c69ef92503dd6 + pristine_git_object: 58b54933b07ebb02ed32c8f8cbdf3c319bc271b3 src/clerk_backend_api/models/listorganizationpermissionsop.py: id: 401995a88711 - last_write_checksum: sha1:b7351c5f9be6c467a8f799672aad022dafc6204c - pristine_git_object: 8dc919ec2f3f4cfbe4086b0c003c02df00994baa + last_write_checksum: sha1:3df68ced66744b8f9f67b4131c604ecf3964347c + pristine_git_object: 06441ee8355227e544c41dbca51578d47a926b61 src/clerk_backend_api/models/listorganizationrolesop.py: id: a049157a4389 - last_write_checksum: sha1:e79571af44636e4d866f48f991d2abf2adfd428e - pristine_git_object: 73d809622993901035bf9772a8dea76a79bf2b39 + last_write_checksum: sha1:1e021d98a0e94f460ef33111639affb512a9afa2 + pristine_git_object: 70c94257e73ab433564e0be5c749fb26932c08d2 src/clerk_backend_api/models/listorganizationsop.py: id: 3c53ef5bf61f - last_write_checksum: sha1:9ff0650afa08c2f41ab945c07000b894d867aa64 - pristine_git_object: 2d5518a4ee630a1968eaa009fdba89da1a3aa145 + last_write_checksum: sha1:1c7c820fabd3ccd3f973a80554254994e4f1ce5a + pristine_git_object: 11881275ff49b08ddeb27128749b280531950403 src/clerk_backend_api/models/listpendingorganizationinvitationsop.py: id: 759ef8eeceb9 - last_write_checksum: sha1:c0d25d2e313c516e40442426f07eea0dc2afdc65 - pristine_git_object: e72d6b5b27d2ee6017abbe639e4113387d5d6b54 + last_write_checksum: sha1:2caf14ccd309c4cdc12d107d6dc341b6623fe20e + pristine_git_object: 34ae64f3021e2fc0e58c6cbceb560caf04781c96 src/clerk_backend_api/models/listredirecturlsop.py: id: 6ff93cfdd690 - last_write_checksum: sha1:b685642702a9e9d20a05df31ddad695aa3e51156 - pristine_git_object: feff60694665654d88958d8815610fd687926e85 + last_write_checksum: sha1:90d5e0dc49d65f9a23d66417038dec1e27304842 + pristine_git_object: 2ed8515d9dbd2c1513d93f5ba18ae0e747b71ab9 src/clerk_backend_api/models/listrolesetsop.py: id: db80404b0d44 - last_write_checksum: sha1:c166973d20a9f8e6e3651b7a2d6f3c29dbe18246 - pristine_git_object: 2911be6bd9e78f081218cf1fb9add8b18ce46124 + last_write_checksum: sha1:7cc63d95028a220c2ca0b9d1c2af5005cee15b50 + pristine_git_object: 2e28410a9243a571bec7cf31eeeb947106369790 src/clerk_backend_api/models/listsamlconnectionsop.py: id: cb529afb3c4e - last_write_checksum: sha1:0a99470f7a8de68525e129126ce59e4f06d753ef - pristine_git_object: efdbc3c1b9a4763500875fe8bcb93aee6bd6f3e1 + last_write_checksum: sha1:e0e63681c3309a1ad0283f93e7aa595d6d56d207 + pristine_git_object: 4fc21d3233a14d475ea6ed136ad8aff7fba1f9ed src/clerk_backend_api/models/listwaitlistentriesop.py: id: a84012b7b658 - last_write_checksum: sha1:bb4ff2ab8990bfc305907b3ff4df837ecf7f30ba - pristine_git_object: 9f338f947282bccef11a3f0a4d2fdfe11d061eb6 + last_write_checksum: sha1:ae38d0632c64165c40b964e5bb40dc36995ed1ba + pristine_git_object: 7cf372f1c8f8184148f23e2698e07dc985578816 src/clerk_backend_api/models/lockuserop.py: id: a2aaab662eeb last_write_checksum: sha1:8e2fd47f6e56303b47ef32bada41e374dba4a5b6 pristine_git_object: 9b84cd23c29874bf893c1242581e9253ba7f09b9 src/clerk_backend_api/models/machine.py: id: b38df0834767 - last_write_checksum: sha1:6a89760dd9bdcf54540718289c991352efb9740d - pristine_git_object: ecc64c8f8ecd93e0c2df4fa351a4cb81ed524d36 + last_write_checksum: sha1:023fbeef5c9550d027ca81cab9f913e12f7e530d + pristine_git_object: 0dd43334bc6741aedd246837c7f076378a6186b0 src/clerk_backend_api/models/machine_created.py: id: 770dcb816aff - last_write_checksum: sha1:ff31b8b02db60da7064303839f9219867d66a6eb - pristine_git_object: c0c0ad8ea993cd6e4758299eabcb5bc8338ce8c9 + last_write_checksum: sha1:e05402b5083cbb10bf79be818990b41e79a2f8d2 + pristine_git_object: 3d519143de91141821b45fae3a8da68b9994aaa0 src/clerk_backend_api/models/machine_deleted.py: id: 5717496f5852 last_write_checksum: sha1:cdf7524dbe0c0ac7b2d747100c7ba2104690298e @@ -3886,56 +4086,60 @@ trackedFiles: pristine_git_object: 9efdec72b33c0e63ecc11f5b3ea256c8d199dc01 src/clerk_backend_api/models/machinewithoutscopedmachines.py: id: 56fc43b97b95 - last_write_checksum: sha1:f5af6eed80590dfea1829719f79561ad722ccbfc - pristine_git_object: d409a13d4d5f9817e54285bc598c7733172594dd + last_write_checksum: sha1:be5a68b22698245114128577986a86bae57b535d + pristine_git_object: 124160bbb406d94c334cfad9f2228df20514c35d src/clerk_backend_api/models/mergeorganizationmetadataop.py: id: 49e007a2b6c6 - last_write_checksum: sha1:1aa95372f7e530cadf46060e6f3792fc3ee4f5f5 - pristine_git_object: 23d3fef429e9a5a2fec2cbe50fe3d3463ffe4d99 + last_write_checksum: sha1:9578861421181022cbc63b35fc426de279cf75d3 + pristine_git_object: 264ebbc973b4ecfdc00aeae943a2159feeefef5a src/clerk_backend_api/models/no_response_error.py: id: 52f74a771f94 last_write_checksum: sha1:7f326424a7d5ae1bcd5c89a0d6b3dbda9138942f pristine_git_object: 1deab64bc43e1e65bf3c412d326a4032ce342366 src/clerk_backend_api/models/oauthaccesstoken.py: id: 11577b03d7c8 - last_write_checksum: sha1:dc61c1e7ac272c2dcdb278c3a742b737dcd78fe2 - pristine_git_object: 69d3f958585721ff08c9b1702487f0b192706289 + last_write_checksum: sha1:14dbbed2d73d16765f66503eb892c886a8e3051e + pristine_git_object: 1a9801cc80011710061d660016a0a44aa7d05e43 src/clerk_backend_api/models/oauthapplication.py: id: b6e3060aaf0e - last_write_checksum: sha1:7a61306fb19fc5ca1c17922ce26f2091924f4c68 - pristine_git_object: 99d09327de7e07bb329390e2f5bfe1a52234df23 + last_write_checksum: sha1:4d4d139e6faad481ea626c3a13e0548ea2d4038c + pristine_git_object: c899f81491887a39c8fbd5577fbd6b7e8e3118f3 src/clerk_backend_api/models/oauthapplications.py: id: 4c7ac174fede last_write_checksum: sha1:01c2a0f4dd55cf4f559906d17c750ca4dccd61e8 pristine_git_object: 879adb3b3327e233c4d252e3f0e8650bd55e4f45 + src/clerk_backend_api/models/oauthapplicationsettings.py: + id: f775c0a6f413 + last_write_checksum: sha1:7c068396e05a997bceed8abe39ee02046350d416 + pristine_git_object: 0110c4187609713025fe0612169171be38f86390 src/clerk_backend_api/models/oauthapplicationwithsecret.py: id: 924cea7b78d6 - last_write_checksum: sha1:5c8d99ec4c7ec21b7ea964f1fc74ebd8865be54f - pristine_git_object: 6b9d38ceb7d7a531c14e05c9476b649dbb21b1b0 + last_write_checksum: sha1:8967e378b5b9caf038e2bd00716de522033658ff + pristine_git_object: 5d7c9a28982f3fe381174e6c285e318bace2431f src/clerk_backend_api/models/organization.py: id: 80ef72d7e4bf - last_write_checksum: sha1:89e27383103373955eb8571a38d070a935baf472 - pristine_git_object: 0df8acd5d72f4a6b9765efb6608d1e85746674a4 + last_write_checksum: sha1:59a3ab2bf1d70c595830fa0ef807fc85c6f92dea + pristine_git_object: e14ddfc94b626a51175a05dfa9cde4d473ff185d src/clerk_backend_api/models/organizationdomain.py: id: 627b7a1a5e5a - last_write_checksum: sha1:4f5c7789fc1b498591f40710eed93ca79932b0c5 - pristine_git_object: e5a85b2380efaa22d4f84ab6dd5e56bf0e4a7d44 + last_write_checksum: sha1:0e3d97b5036b8ceb79b69f52d5f114e65d57b299 + pristine_git_object: 32ed0f3fe0eb87398c2c5e30d9c5379640e54103 src/clerk_backend_api/models/organizationdomains.py: id: 7bd99087d029 last_write_checksum: sha1:d3fed2db47a386709a3f89e37707a5ece87fe3d6 pristine_git_object: 6bdba7209e291b318c8af19a6c705ced62991266 src/clerk_backend_api/models/organizationinvitation.py: id: dd8ca48e7d12 - last_write_checksum: sha1:cd4376804ddb7a548d36a5d5df4f8c2dbd036499 - pristine_git_object: bb5627875daa621e49b5fd174270cfa49e9f3ef1 + last_write_checksum: sha1:af519a7141a715b3a57128d96d3dd9998547f3d6 + pristine_git_object: 0fd583f69244a8cfa4c8c4f12176728947a6c399 src/clerk_backend_api/models/organizationinvitationpublicorganizationdata.py: id: 575b3f8fcbd6 - last_write_checksum: sha1:f5115e7096f86f616371003e4196cbca0a6d104d - pristine_git_object: 14174a92cbc2eba449828ba1ded4a8831887c13c + last_write_checksum: sha1:ea3886f5e632fc396461eb698ea43177648087a1 + pristine_git_object: b6e906c3f0ab6d8b20fb37b7c1181c55beaa8dc4 src/clerk_backend_api/models/organizationinvitationpublicuserdata.py: id: 13a77231f2e6 - last_write_checksum: sha1:6404c48d39c96f6255d4d4d1ce32c4d5f075e1e9 - pristine_git_object: 1bcc9a7ab9b215498d0ac5a8d7e7992921f27f33 + last_write_checksum: sha1:476df4475a07123c7876547a766f0629196a81be + pristine_git_object: 37c438f1054863dda819d1a4e9d6db629f035900 src/clerk_backend_api/models/organizationinvitations.py: id: c547efe783c4 last_write_checksum: sha1:4efd36f333c9697be79cc99670863525232b2b83 @@ -3946,16 +4150,16 @@ trackedFiles: pristine_git_object: 4ba639d78645a3b75549d17b335f69f0dfed370d src/clerk_backend_api/models/organizationinvitationwithpublicorganizationdata.py: id: a6078d964aa7 - last_write_checksum: sha1:ff52a9df044b57b84c90861e87650d16717b9a15 - pristine_git_object: 8b5b670b99eb218d6c57f5b27aa78f648d0778b2 + last_write_checksum: sha1:cbcd2c7fad18c1a503d6bdd2ccabace200393fe6 + pristine_git_object: a79eab9b816a068a2a15ca6b562c4117c7b30654 src/clerk_backend_api/models/organizationmembership.py: id: b88b3dca6da2 - last_write_checksum: sha1:85dfaf692e598975fd58acb1495236df6ab0d94b - pristine_git_object: f38296fc5e5cf0a7b61fdc76edc65302112ee961 + last_write_checksum: sha1:89ca102492a514bcf45e043419ee850e805881b6 + pristine_git_object: fb12557339f100c3841c6ecebfadfda9c28b3237 src/clerk_backend_api/models/organizationmembershippublicuserdata.py: id: f5370bc52443 - last_write_checksum: sha1:f17f725e2b3d8ce4606025cc98c8471a66dd91a3 - pristine_git_object: 61ec55d04a963ba31400149b5c6cf75046f4f2cf + last_write_checksum: sha1:a5cfc8bc8063d7518c461b5471706082c97a76ef + pristine_git_object: 2107e2ac8eb12cdbb3121ffd79d1b190ed7eb307 src/clerk_backend_api/models/organizationmemberships.py: id: 258d894e5b88 last_write_checksum: sha1:be0b4c77a757e43d7d16d45c3290815e1fd8f9bd @@ -3966,12 +4170,12 @@ trackedFiles: pristine_git_object: 6715514c1723f36103d08b0515b2a72181d88f22 src/clerk_backend_api/models/organizationsettings.py: id: 29f31551cc85 - last_write_checksum: sha1:33dabb244d447b5752e54c5c8a4d69c0b81ac860 - pristine_git_object: fcc57344aa335ac7246c139f32e329bde1b5eb1e + last_write_checksum: sha1:6f121c9b885a7b2e5a32f49822eccb91e5bb0894 + pristine_git_object: 8c0db9cfc16beb7abc72a8ee4ee9f69aa60389c1 src/clerk_backend_api/models/organizationwithlogo.py: id: 39e7afc96dd0 - last_write_checksum: sha1:1ef4eaf04d41f20aeaee19145d3bb3d39037af1b - pristine_git_object: ce8c08569d19cebcbb967916129aeb3e460d29a6 + last_write_checksum: sha1:d51efaa9884e2d989969c70d0b909edfac69b7e5 + pristine_git_object: 4d4070708d1d82895961bc1f16797eb646e69cc1 src/clerk_backend_api/models/paginatedbillingpaymentattemptresponse.py: id: a30c95e05339 last_write_checksum: sha1:7b50424f68eb4beeabe7b551697b53ab1e60c51b @@ -3994,8 +4198,8 @@ trackedFiles: pristine_git_object: 63845298687bec15116841e4390c6d0d1d830e14 src/clerk_backend_api/models/passkey.py: id: 09aea0b132a6 - last_write_checksum: sha1:4e49b27d032093650e622270836466e328371cbf - pristine_git_object: e5e379fceff9e495e27e5b35e40260bca15032eb + last_write_checksum: sha1:bed2f477c888f8496497f753ffb9f5a8fcc66c8c + pristine_git_object: 57bcba26b6d0beb4c75727533bcbbdf7154068f0 src/clerk_backend_api/models/permission.py: id: 725c343a939e last_write_checksum: sha1:9f550259f144b54884328ed3d3beda0132f54a36 @@ -4006,28 +4210,28 @@ trackedFiles: pristine_git_object: 1f26ccef3cb6e58c4f011937021f5edc48784408 src/clerk_backend_api/models/phonenumber.py: id: 482915240b97 - last_write_checksum: sha1:5c6cae9afdcd12dc6be936f62e785f2e5f3cf37e - pristine_git_object: 775ecbba912d4d70b3608878d9b930c984c15f05 + last_write_checksum: sha1:e20257fe131db85b3c9ca9406f92f58f1ac1a215 + pristine_git_object: 499dcd63884cde9707cad8c161aec61216876092 src/clerk_backend_api/models/previewtemplateop.py: id: b2a71f626359 - last_write_checksum: sha1:2d4e84f002a185188d6e379a7dfe38ae116dcad3 - pristine_git_object: 1b3908814ae29a18c602312e2d1d0f4985103a87 + last_write_checksum: sha1:c92d0bb8a02e1a14c3c8f9ecc41b5824a00834c9 + pristine_git_object: 186e6b0b2523c1cda66ec0cbbcd4a25c075e5272 src/clerk_backend_api/models/pricetransitionrequest.py: id: 02b3d317f840 last_write_checksum: sha1:261efa52088f3481dd7db7991b2624b081eb3271 pristine_git_object: 7561e53814ca457dad0c6df8f3baadcc8c39650f src/clerk_backend_api/models/proxycheck.py: id: 304c1a2b3b12 - last_write_checksum: sha1:21c85773efb93448f5c7939e612c18cd0514b61d - pristine_git_object: 22d2634a62e6a56c056e2c5099f5627452c99c8d + last_write_checksum: sha1:6f63b96609c54222e1611a8445cb6c73bf066797 + pristine_git_object: 110aab8db91da8fc6d2ced8fd6570a6b6752ce9f src/clerk_backend_api/models/redirecturl.py: id: df2e19f4a63e last_write_checksum: sha1:5c94340c32ec2ad8925c6841ad5268866fd922c7 pristine_git_object: 2e7218642c637f6a6c5ba1635c5ab513669e9d05 src/clerk_backend_api/models/refreshsessionop.py: id: 4cdf74c6f9e7 - last_write_checksum: sha1:f088139b228394187398a1c22c6f003a58741572 - pristine_git_object: 5a5ed043bba47242e571a5a69043dc0f60239b92 + last_write_checksum: sha1:ab8025373f164d98756764f580cdf68b03a85c85 + pristine_git_object: 46f71f6ec0f0ddb0bf25855247c6c5cd035cfc42 src/clerk_backend_api/models/rejectwaitlistentryop.py: id: 5125249f4a11 last_write_checksum: sha1:9ca38e7bfbd5fdf4b007becd426268cdee883444 @@ -4042,8 +4246,8 @@ trackedFiles: pristine_git_object: 939bea74e35ac1d028cc279373e5f457fe0e7561 src/clerk_backend_api/models/replacerolesetop.py: id: 8172861fba24 - last_write_checksum: sha1:bd7574ff01ef66d4ae10b3e8125c46871d54a586 - pristine_git_object: d114cc0f7eead8cb07b32538820a8a68bd7b15da + last_write_checksum: sha1:8277507f3c190daf25761f8b4db0fe4e455f61b8 + pristine_git_object: 8da7e8c425f63309be5014cbaacc5881560cb9c4 src/clerk_backend_api/models/responsevalidationerror.py: id: f06daf48a102 last_write_checksum: sha1:cf6ce06c477c6c994e86d95a55ac52b87c2218a7 @@ -4056,22 +4260,26 @@ trackedFiles: id: 2787d5681265 last_write_checksum: sha1:a1862f1ede4732d28a2be15b28eb6568d7564e09 pristine_git_object: feaa89ce377c88c40b737aa878db85dca8983d6b + src/clerk_backend_api/models/revokeagenttaskop.py: + id: 72f2f432f1e4 + last_write_checksum: sha1:08e039a14338ffb9fa7ab2626bd0109c6dbfb309 + pristine_git_object: 21487c9890a7224a7a47f1698c7ae0cd72680631 src/clerk_backend_api/models/revokeapikeyop.py: id: ccd54fbb5b1e - last_write_checksum: sha1:6901c1f330e9ce0f3fb6ff37d60fce85ff5de5ae - pristine_git_object: 5dbb10df8944721c0668344703b4a7c6ab5f340e + last_write_checksum: sha1:9f01480274a12f0dc01ee7a82a48d10a0f04441e + pristine_git_object: 6b06431bc7e1d9946ddbec3b2c9d9ed757b9c2bc src/clerk_backend_api/models/revokeinvitationop.py: id: c2c551aa3fb1 last_write_checksum: sha1:b5a7ea1c95744298893ec7033c6f861dab778509 pristine_git_object: 2f4e1cd62a176c40fb58baa0ced5c80744ec5e0a src/clerk_backend_api/models/revokem2mtokenop.py: id: d9c1d604d521 - last_write_checksum: sha1:727c4c702f687b8e80774be98919cd70ef8307f8 - pristine_git_object: 8cfbf58cfe53bc899aae5bc55b6223a1f26eddb5 + last_write_checksum: sha1:094fcd51b02ce280744ea78f01032ba64f1a92d9 + pristine_git_object: 28ac5ea7ec338fecb160561ca63ecf76ccf4d9a0 src/clerk_backend_api/models/revokeorganizationinvitationop.py: id: 55fa03fa4268 - last_write_checksum: sha1:0137e1f62d1ce2a2a95b6c419c30481e198f524a - pristine_git_object: 64d6c11ad999796bc88e9f25d959fcf55a6a1d83 + last_write_checksum: sha1:4361e449fc29121d49f493bfb0fc538a52618b34 + pristine_git_object: d858d175a22735856c0b167891e8b054190b6dd4 src/clerk_backend_api/models/revokesessionop.py: id: a53d54983847 last_write_checksum: sha1:d407fe690e99b45d91bc16d960a0cb7f6b237da2 @@ -4082,20 +4290,20 @@ trackedFiles: pristine_git_object: 4aeb54aa92e9facc7689e9d18bf03f054ecf2728 src/clerk_backend_api/models/role.py: id: 24a2f2f91439 - last_write_checksum: sha1:91fe768f4e0e45126195e6538816c7ab30684619 - pristine_git_object: 254cab2c8e2aa8d9c4be241d2fc645e6cef3030b + last_write_checksum: sha1:5e1602a71d79141fe2c525ca324d2b28010e7f47 + pristine_git_object: a4ae31f5c55fd81de32490860dd6daeaa5af36d7 src/clerk_backend_api/models/roles.py: id: 6a21f4fdd123 last_write_checksum: sha1:d9ee432233d99b901b0f7d32db3f00068582b6f6 pristine_git_object: b05c11b5a81fcf4db9e3cb3cef2dfa044e6aa634 src/clerk_backend_api/models/roleset.py: id: 8786c2b04e26 - last_write_checksum: sha1:070486f3c0e3397d3dc1d2bc0fba4191e5b862bc - pristine_git_object: 49dbde0371c305bedb1957ce9a934d1f00136012 + last_write_checksum: sha1:be100b4bff64f7b1e540a9f71c538f1fc6081c8f + pristine_git_object: c6b09d70d58d72d384c325b9922322f14d089fe0 src/clerk_backend_api/models/rolesetitem.py: id: 42f901635064 - last_write_checksum: sha1:b2745779a7ea6bfff33c80b31541d230ad337899 - pristine_git_object: 7f3e8754c18ec89127e1fd0d1b2e99cf67c175de + last_write_checksum: sha1:0233ba4d2c9c5cb7ee97ded05d51e9727999d15c + pristine_git_object: 242bd7a018ee9130cbb7b3469fe4d6d3e420a53c src/clerk_backend_api/models/rolesets.py: id: c04be7307e3c last_write_checksum: sha1:d26438ef019c6e4645e088ffdd2ccb7120aecfa8 @@ -4110,8 +4318,8 @@ trackedFiles: pristine_git_object: 4c0586ea03498ce190ecc66ae7e25405f4878633 src/clerk_backend_api/models/samlaccount.py: id: 49087d16fc62 - last_write_checksum: sha1:926d6b86bcf7dfadf1e6795242a76de6285b079d - pristine_git_object: bd590c3d71cb3a2617dc5483aa87f7fb7b71d464 + last_write_checksum: sha1:2af4e3f85845adf0e7e26340d00abc7e1625c2d0 + pristine_git_object: c8a91822774f12aad056f61d8603dfcd770cedef src/clerk_backend_api/models/samlconnectionattributemapping.py: id: dd9563c2bade last_write_checksum: sha1:d15a2875f032ec073d28ec1b98820799a8266cf1 @@ -4122,36 +4330,36 @@ trackedFiles: pristine_git_object: 2d04651214b1105ef337d000ffe6a3e4d531ba99 src/clerk_backend_api/models/schemas_commerceplan.py: id: 67304214fcb9 - last_write_checksum: sha1:65a49137701b6944763ad0104fe1752625fc16d0 - pristine_git_object: 153423e2e70cca88db8ba4bb2b9c5835902eb924 + last_write_checksum: sha1:a15ad51b171754206a66ac2327c405b5e15effc5 + pristine_git_object: cf360a12fd23e0678f2db9fbbbe558ededc6fa4c src/clerk_backend_api/models/schemas_commercesubscriptionitem.py: id: 3913a47cc4e2 - last_write_checksum: sha1:ce3482e75f93aaddb6a01a30981ab61f95b87508 - pristine_git_object: 006a37d236288e205c068ed9f92d51ce5cada3eb + last_write_checksum: sha1:9fd43a397ba535bd6ff6772faa261cc78babd165 + pristine_git_object: bf4b219a518354096fab911168359431b4f0061c src/clerk_backend_api/models/schemas_featureresponse.py: id: 6defa699c0c2 last_write_checksum: sha1:8b7e9a93a74d40a89005b77bceced6c95575cc8e pristine_git_object: badd84478b828f4ea140fb3c8805247992af0557 src/clerk_backend_api/models/schemas_samlconnection.py: id: a3bc0ed49651 - last_write_checksum: sha1:90b64eceb819618e3d281ea3625901a3800eed76 - pristine_git_object: 9c4e1b3fee9bb70193d3cec442ab2232c564c645 + last_write_checksum: sha1:bed85e31387a6d081b6cd09a91df3e87d06752cf + pristine_git_object: af1015ff49876861e8b6d55b6d406a214ee286bc src/clerk_backend_api/models/sdkerror.py: id: b9a19e5580e3 last_write_checksum: sha1:5e2c978b6a359bdc765a5e52987604be9ac3dba3 pristine_git_object: 2eb5461df773c2b299f8e49fddb77c3184b76980 src/clerk_backend_api/models/security.py: id: c6c7d036b1c0 - last_write_checksum: sha1:f28fda09fb522d44a0b03210c2c9e69303fea6ab - pristine_git_object: fc2d014c6409d1fd6c1b02b3ba4c097e089ec141 + last_write_checksum: sha1:217146f9e3a028adbf9abd37463b6cb806473a52 + pristine_git_object: e726c975ae3585882ed1f5a71db4ba3987088259 src/clerk_backend_api/models/session.py: id: 55446ac797d7 - last_write_checksum: sha1:3ffe2b0cda1aa5c2e608f9f1914cb489b2e5ab09 - pristine_git_object: 3f6cc39afba06a294845e752d0768e3455fcc111 + last_write_checksum: sha1:1214e0dfaa20a63eb4acf316008f4509607d1bd2 + pristine_git_object: eae7aaec86d6182d53a8328e9ddcf5cb51c6b4a6 src/clerk_backend_api/models/sessionactivityresponse.py: id: 33fa48685355 - last_write_checksum: sha1:800bb55b1a8bd627eb947b132cc95bfe0445bcb4 - pristine_git_object: 46833ff7344a638c120c1db8933cb057ce93e9de + last_write_checksum: sha1:f3a71b59b9d610f1d99a579a05d6da63c237cbed + pristine_git_object: 1687f2b4651a99ce102a392f7ca1b409ec4d77bf src/clerk_backend_api/models/sessionrefresh.py: id: 081c4c551da3 last_write_checksum: sha1:7f3e3c9c8540873d78f51e53708e28f14336fdd5 @@ -4162,44 +4370,44 @@ trackedFiles: pristine_git_object: 02b2bc723d1da733b7a6118fbd9ac446f567934e src/clerk_backend_api/models/setuserpasswordcompromisedop.py: id: ed189a5410f0 - last_write_checksum: sha1:a546de4e70b9ca1a87fd7e6708654f503031952d - pristine_git_object: 3eb632d44b7c8ce5819671d8067d52971d3fd3e4 + last_write_checksum: sha1:8100c71cc40747f3c89719685f9a6874953d199e + pristine_git_object: 9e2391ffe977982bfdf2ef18a6984e5041c33e74 src/clerk_backend_api/models/setuserprofileimageop.py: id: 03a938d0a33c - last_write_checksum: sha1:d4bab1a376653569bb3e61bce06a922cffd808c3 - pristine_git_object: 30e02493b9fecdcfeda0eb4710dc140e98f3f68b + last_write_checksum: sha1:13bb526f838236916a07a5ec3582cb214d0fe796 + pristine_git_object: cca96e4ad7e554207907e6b6ae1e37c4f7208911 src/clerk_backend_api/models/signintoken.py: id: 0de4cbb3f8d4 - last_write_checksum: sha1:9173f5d6e00270be40487e3e704a8e927976f04b - pristine_git_object: 657cb69cb372657c08f588de313de9bf995d8390 + last_write_checksum: sha1:61213c24f6dcef4ea435c8d31953d506acb0ba7f + pristine_git_object: f8d1872d89c9bced9b8bbc40f72f835b3398e44e src/clerk_backend_api/models/signup.py: id: a5a71c74fb54 - last_write_checksum: sha1:f939cdc71d84cc6bbe356c9223498bbfbc1b2c2f - pristine_git_object: e5e3485c5b645e30a8dd1c34c3fcf16ac3184ce5 + last_write_checksum: sha1:ede325ca3c78d2bb08d28f902ce109bcf6b47e3e + pristine_git_object: 1e89244a2b6076bf0a966cf1cdb7557b5240f8be src/clerk_backend_api/models/signupverification.py: id: d01b54c7f836 - last_write_checksum: sha1:eda9f775585507f937b17743df93ca7f3e24a364 - pristine_git_object: 31c36a8ef2b3dcf1e1db3cf2474937731a9d74e6 + last_write_checksum: sha1:9f6b370e8aff26be2b6b5bee9df9a384f77ef4ed + pristine_git_object: c475c711ae143e51045e943db7b3d7bf9d83d150 src/clerk_backend_api/models/signupverifications.py: id: 2ca59d04bd48 - last_write_checksum: sha1:b224743186ef88299194542f01e61bb7bae64b49 - pristine_git_object: fa578bf2f9843b5b19798622e9b49ac6b5769314 + last_write_checksum: sha1:442be9b9cbcc5897f6c8d5de991d356e5e0c0968 + pristine_git_object: 01d2eb5166ff62022e54f91dcc3a0b2115e4e27d src/clerk_backend_api/models/svixurl.py: id: 24275c02407e last_write_checksum: sha1:8b91f5f5e4b00a150c39759a6aba0b52aa43f866 pristine_git_object: 359d58b3dfb84c672f28a3058eba3808c87731af src/clerk_backend_api/models/template.py: id: 2fd0f341c193 - last_write_checksum: sha1:ea8fa25c6a58bb364906d028665ecf3c21f99647 - pristine_git_object: e31a293d6712adf0e4c369aca6383194c6c31750 + last_write_checksum: sha1:0d9febddf0949c1d110442d29355d47ff8ea3efe + pristine_git_object: c12c7896f37c9f212beb032a9ca620085d12ddb3 src/clerk_backend_api/models/testingtoken.py: id: e296da75f056 last_write_checksum: sha1:b4ac51693a6c611b3d65a095ef381f989889d64e pristine_git_object: 241f5e47a1d6fcf93a32fec4e49fa892ed1d1db8 src/clerk_backend_api/models/toggletemplatedeliveryop.py: id: dffab61ac7ac - last_write_checksum: sha1:198b5cd7a01d1b9481bdf234246e43e266196926 - pristine_git_object: 46b71769284b0b45c54464a962e5cba7299e2d01 + last_write_checksum: sha1:a665d446902aee500cb5a63cf62c32bdce2af2c4 + pristine_git_object: 03b41233b06f54cac05063139d60a9caabefc879 src/clerk_backend_api/models/token.py: id: 25bbd03c6ed2 last_write_checksum: sha1:bb1d75de51e1712431bf7ac54b045738a87b7ad4 @@ -4222,112 +4430,116 @@ trackedFiles: pristine_git_object: 17ebdc0558cb4a95b8c8920585e18c6fb7b69f5d src/clerk_backend_api/models/updateapikeyop.py: id: 0806fcaf3c52 - last_write_checksum: sha1:b13e0b097e59e84dd2748f20aecdd04264de10e5 - pristine_git_object: 36d8c05c483f930fd17d507e55a070187de0c596 + last_write_checksum: sha1:9e5659431bd5868a19d122ba4bd18ddcebb3aff8 + pristine_git_object: 49ec65b5c29a6943a4b75be4056b92687e4aa142 src/clerk_backend_api/models/updatedomainop.py: id: e48432b285d4 - last_write_checksum: sha1:ca0c9029b8ceaab07f0635127b24f63b6881d7b2 - pristine_git_object: 5461eff31870a8e3fe192bd16d731613acb64fbe + last_write_checksum: sha1:4787fbe0814e412611a7999786c35cfaaad5cff2 + pristine_git_object: 039c31156814b106f8312e4dd82d326f13b0ec77 src/clerk_backend_api/models/updateemailaddressop.py: id: 745bda839938 - last_write_checksum: sha1:80d5cd0fa56504ea9d5a2098ed255acbfcf155f2 - pristine_git_object: 72b76f23693076baead95c246e385a12358cd376 + last_write_checksum: sha1:517205e44700f0702817ec34baf240f31f29d7d2 + pristine_git_object: 595dedced1e0196e8bac9e03f7579cc8610f4a85 src/clerk_backend_api/models/updateinstanceauthconfigop.py: id: e4d1c554c8a8 - last_write_checksum: sha1:e064d9c1266c92a57925b663ddb7fff271393575 - pristine_git_object: 5c82ef4058c0c8301b2f30e989162d32e07a8980 + last_write_checksum: sha1:0a7ed65be461eff84e481fdd61f652c4214dd001 + pristine_git_object: 4b96ae06ff27ebe81b855e24dfa4c1a165581604 + src/clerk_backend_api/models/updateinstanceoauthapplicationsettingsop.py: + id: 78731c1e424a + last_write_checksum: sha1:7d61d19deef1b91e10cda7c7c87a211c5639ff3a + pristine_git_object: 516e7527c3177d755fc1be92b602b367cce4a94a src/clerk_backend_api/models/updateinstanceop.py: id: 40af0297ff55 - last_write_checksum: sha1:076f0a64b7f9b8687e488bab327052a577739152 - pristine_git_object: 81a9dbe0a8a4ca4f8ba3c41d5d0ea331120971bb + last_write_checksum: sha1:18cae5a1f1155ebeb92be3b2ae9cdb3a8b6bc883 + pristine_git_object: cd08a835e1e66fb8295988f6508628a5ea52f896 src/clerk_backend_api/models/updateinstanceorganizationsettingsop.py: id: cfc65d736c99 - last_write_checksum: sha1:0e364e786e2a3d2e76ceea84fcc31ba7ffbabb8c - pristine_git_object: 6a838b785ab8fc7472a66cd8dd7258057a9623ae + last_write_checksum: sha1:7e8ee605fd857a323a481bd04389e3ab2df164df + pristine_git_object: d91b2d616b7c03d0e1d5ddb66417a57c7ebe648d src/clerk_backend_api/models/updateinstanceprotectop.py: id: 7e1b719af3db - last_write_checksum: sha1:5b3cc78e0fc9275c597c3abb398ffb89ffef1f86 - pristine_git_object: fbef838669593768d979096c3447ab0b85aa68e8 + last_write_checksum: sha1:f2371b29a77b82d0f1e413d005e920ba6518aac3 + pristine_git_object: 3ab7addf4dc623ee0709d04d42702f2128e697ac src/clerk_backend_api/models/updateinstancerestrictionsop.py: id: d8dfacb6c7ac - last_write_checksum: sha1:aba80207999884cd4c95ff72d5ad6c49e3174cf5 - pristine_git_object: 656ee66b5bb58c8e8aefc13ca8b25518c83f5411 + last_write_checksum: sha1:cc08142e4f26a0e0fc336a516650a4743a0df05f + pristine_git_object: dd7688a6b85bad757033ed8101a31d4a0ab99843 src/clerk_backend_api/models/updatejwttemplateop.py: id: 5269c6339a2e - last_write_checksum: sha1:90b51ee493e6745634a076058270d687f2c97217 - pristine_git_object: 0d91d0c578a40b67d642f7c1f06f421f78418c82 + last_write_checksum: sha1:a8614a5a6f8684da7c6c4f1d0fa2e824d94016c7 + pristine_git_object: cd8c0f7dfef4f2ab738fa1b268323ed5e0745d12 src/clerk_backend_api/models/updatemachineop.py: id: e8fcb3f28d02 - last_write_checksum: sha1:ce87748430e01405eeba63cbe05b09103893ec1c - pristine_git_object: a92c575b02e88f349be37480447bbd88159e36bd + last_write_checksum: sha1:0710e23efdcdee7d691793d15cf752e75864a597 + pristine_git_object: b1b964b0890a904b2273320ac063996204450c3e src/clerk_backend_api/models/updateoauthapplicationop.py: id: 51fa6041548d - last_write_checksum: sha1:a9725bf3c064a90ec3f4bec8e15e23d711ef16d3 - pristine_git_object: 0419fb4acd7e4ce0e0d8e3775399281ecaab1f63 + last_write_checksum: sha1:99ed0ad7245d81b52a1c8d691b59d44ba06b91be + pristine_git_object: 4775edcdb8659a808f1f54bd1bd334c91eb7b195 src/clerk_backend_api/models/updateorganizationdomainop.py: id: f821cc2481cf - last_write_checksum: sha1:811cd28ae7737cff845375f31b4426ff722e0d97 - pristine_git_object: 8ba026e9d60f99afd1f2e742ee081929d5a9dd4f + last_write_checksum: sha1:9597106f1033c03c83275e126e503d23521c1dda + pristine_git_object: 44b6a62a8d7206bb5e4795b106e2fc9f2f5f0cc2 src/clerk_backend_api/models/updateorganizationmembershipmetadataop.py: id: 20595ae3f1a1 - last_write_checksum: sha1:539b94431d6d02817fabb551f5245be468cc91fa - pristine_git_object: 488a09501eb0a76f119dfe5b984dcdf6d9e67d09 + last_write_checksum: sha1:4d24811a2c48d34e2ec392b97ab6bbd24f89a32d + pristine_git_object: d6bfdc97cd00fc698d20f989f10f86816a5c954e src/clerk_backend_api/models/updateorganizationmembershipop.py: id: e5c2460f0700 last_write_checksum: sha1:da102ae18a0761ba0e643a0e5f51afc5e881579b pristine_git_object: 2ee3ab0f79d6cae0f1e1a6d5f42abc63c78bc82d src/clerk_backend_api/models/updateorganizationop.py: id: 2512f0951ecb - last_write_checksum: sha1:d3305f665dac2099d338bd72f490b03045fe8075 - pristine_git_object: b0046ae8063606a62a0f52eb58d37382aae2c995 + last_write_checksum: sha1:faaa5d8ee3bc6632706e9ffe3420d2d634646256 + pristine_git_object: ace77af3277ffd5fbae55692262f518a25cb8209 src/clerk_backend_api/models/updateorganizationpermissionop.py: id: 20032baa3021 - last_write_checksum: sha1:f8b7e53916541455ae5b3087c05b824ec983a532 - pristine_git_object: 21e47878375d76c7cb2de161dd0ceb74a25c31ef + last_write_checksum: sha1:a39e653648ea550fa2bd53160642b6f394b88217 + pristine_git_object: 25f5c0ce3039d45dfa36d00b5bcb9604203a3c4a src/clerk_backend_api/models/updateorganizationroleop.py: id: 2961ad02e30e - last_write_checksum: sha1:08065f3849ff3d03fb8fba9b8ae07f22908f0b22 - pristine_git_object: cfabaa08adddc2a088bb702f3d6cf28f1760b8e4 + last_write_checksum: sha1:f5d1171bf16af1e5d812efdc8c96bad0d5928416 + pristine_git_object: 23c1b064fdb0f43bb13a4a3af2b897aeb17d36d7 src/clerk_backend_api/models/updatephonenumberop.py: id: fc9ed623b486 - last_write_checksum: sha1:75b46de5e9a14989b70704cb0cd34a4cd776672b - pristine_git_object: 89ba0eaa3f1eb3729faf73c702323ba3ec07ac37 + last_write_checksum: sha1:fdeaaa3be2c42ff75fcd87e5c8eddc534de66032 + pristine_git_object: 456fb5cbc08a1e217cd4b8d6d081959ec8064f79 src/clerk_backend_api/models/updateproductioninstancedomainop.py: id: 9c8bb4bbf70a - last_write_checksum: sha1:cab9de14b728f35acee7bf9d85b526baa3d09da5 - pristine_git_object: ca60067e3117b45eb036b7b0cccf696397d411f4 + last_write_checksum: sha1:d1f46082cde324077b593ee4071a2a78e3021158 + pristine_git_object: a8b9ed28eee0068b1904ae9813c7b92e8b81d3f5 src/clerk_backend_api/models/updaterolesetop.py: id: 821eadef95cb - last_write_checksum: sha1:8c53d78989fe44292d2bc20e2cc1350bc0c625e4 - pristine_git_object: 3c5638403e3d1fc2f1a2513f0404f6ef47eae4e5 + last_write_checksum: sha1:43784753e90582325f53ec6763124a2cb9daab9b + pristine_git_object: d947e910a7c880cafe01213816ea378bdf4d1081 src/clerk_backend_api/models/updatesamlconnectionop.py: id: 144ab8498bec - last_write_checksum: sha1:f87464a6cca3a335027e46f8588bd5d1bf4da033 - pristine_git_object: 80624761fa8f436a6d791dcba5ac0236b0a7c8af + last_write_checksum: sha1:929af31f3d39131a4b5085c27ed6042eead29db1 + pristine_git_object: 87abc42e863fefdb2e843227faf9d994b9be3993 src/clerk_backend_api/models/updatesignupop.py: id: 8d2a3b3dc83c - last_write_checksum: sha1:4d49588c32efe90651a2b858ae9ff52fa6ee6627 - pristine_git_object: 957d5aa63630edbe22f93d2a3faa3cad38921f29 + last_write_checksum: sha1:3ada82503b73a33b5d385e67a4f450668e4180d5 + pristine_git_object: 6615769fe01c52d8a96b568a0845df1494f9f91b src/clerk_backend_api/models/updateusermetadataop.py: id: 3157339ad9c0 - last_write_checksum: sha1:8ad64c4c38b273a01397145e77cab69ed7750657 - pristine_git_object: 789a90a8b6dbd04efb64bde677d70bdeb6927ee5 + last_write_checksum: sha1:5ea34ac50fdc9ae96682879fcfc507cc0b3c49d0 + pristine_git_object: 5472bee799c8c9af8186b7ec0a49130703153271 src/clerk_backend_api/models/updateuserop.py: id: ef223ada8638 - last_write_checksum: sha1:80eb9c49524ca3dba1067c1fef0d2cbe67eec382 - pristine_git_object: e6e96fb7c91abe4dbf1eb09702317756ef623d98 + last_write_checksum: sha1:93fdfac1091da0476b05bbeb9a1125c154132779 + pristine_git_object: 6f60621555b6ea0e599185ec527fb259aba6a7ca src/clerk_backend_api/models/uploadorganizationlogoop.py: id: b1d30098ca9c - last_write_checksum: sha1:8ba0a1b8799a7ca15216d0e58319e2cc6b6c380f - pristine_git_object: 48415c8d4873e5ffc0e2c6e50715aa3052afb797 + last_write_checksum: sha1:f0fd1abd572ecde4fa27394d0ae9bd38aac58b5c + pristine_git_object: 0b6a720fc6d96a6705b1eedba60f80a58ad9e076 src/clerk_backend_api/models/upserttemplateop.py: id: 01e18aa27ef2 - last_write_checksum: sha1:1427e88ccf9200ce8a127d355a12a5c2f5e42060 - pristine_git_object: f4497c78214a0816070c0b740cccc4b4b5a4efbb + last_write_checksum: sha1:42a6db50309823630b702e5fc35eb4fcfe3659d1 + pristine_git_object: ef8a1b4331c3b8d3dfb1f54c759f312acc40b378 src/clerk_backend_api/models/user.py: id: 670e52d1fa4e - last_write_checksum: sha1:7cf4d59bd5c2c2d191347c6e2cca95eb93efea2a - pristine_git_object: 55f468b801f3c0c56efca78923292efd2cd9c225 + last_write_checksum: sha1:e8bc8ff37aa662d4c36cd421db3d8e5f96431730 + pristine_git_object: 87cad551cb5bd877a349a468e8d0c6deecc917b2 src/clerk_backend_api/models/userpasskeydeleteop.py: id: 28b3f343b764 last_write_checksum: sha1:e25d07c5167b6afad3bb5f48d4d35c85759d349b @@ -4338,12 +4550,12 @@ trackedFiles: pristine_git_object: fd348fab96310f54a5af5c025e8543e137c8bfae src/clerk_backend_api/models/usersgetorganizationinvitationsop.py: id: 876182abfd66 - last_write_checksum: sha1:354f1e9d14b2536c3f284a1bd7331956e29f2295 - pristine_git_object: ecdf9979f2384fdca8a82195e67fdc0485219469 + last_write_checksum: sha1:48556ac2fb65e2a6084a0cbbbf9b7157ff156f33 + pristine_git_object: 6b7ac01f6310a7bb63efe2dd287850c10a876032 src/clerk_backend_api/models/usersgetorganizationmembershipsop.py: id: c8dcefebf5e6 - last_write_checksum: sha1:91c83561cd3fe4a8b7c83adda8da1d33f59f5e0c - pristine_git_object: 38d4f67e9850d8168b9490eb14e4893642793b94 + last_write_checksum: sha1:26bf65ba16bc7a7f87816240c4305251c0d88be5 + pristine_git_object: dbc7d5f9c04edc04c9f66b4829caa9f8271b3ef6 src/clerk_backend_api/models/usersunbanop.py: id: 07a1904d2b87 last_write_checksum: sha1:4480169a8c20ed7c206ced48554925a478179bb8 @@ -4354,44 +4566,44 @@ trackedFiles: pristine_git_object: 2e9f3a450b613a21e47fab445c7fc5176d59c76e src/clerk_backend_api/models/verifyapikeyop.py: id: 7150cd708098 - last_write_checksum: sha1:9e5d7ac4d088bb09f74b2e069222bdb5221cd5e8 - pristine_git_object: 191652627edcd0f77a116c1894b9ac81f1d12c1e + last_write_checksum: sha1:c8e6c024163137f34b2608a1a234ab864f918b46 + pristine_git_object: 9204be32902860ffd3d58abcab00ac512f2b9404 src/clerk_backend_api/models/verifyclientop.py: id: adeeb384f0dd last_write_checksum: sha1:2104e8cfd6bf9e0aea42e200cc105642dbb00a51 pristine_git_object: da78ccc40021d0e5cf12d7f80489634648bdec73 src/clerk_backend_api/models/verifydomainproxyop.py: id: 522e9634b8d1 - last_write_checksum: sha1:ad6451aed376fa86322e25064c80cfab29312e78 - pristine_git_object: 374a18d63d0dd08758bb4d5bfa9eb7b3b0c62a4c + last_write_checksum: sha1:f29399f16e701b9d75ba1c69a9b425153b40c3e4 + pristine_git_object: 30309be9207595b319d33468a2a8a681586c90d3 src/clerk_backend_api/models/verifym2mtokenop.py: id: d05996640ead - last_write_checksum: sha1:7ec926fb3963b58a2d521419902f7ceda92eab40 - pristine_git_object: 63b2318c5bd9a23c9809d52096e599dbaa501a99 + last_write_checksum: sha1:ba04369f69dcbcd11ea28291d57d79074193726c + pristine_git_object: e0ef401c693769f0c6ccb9fc2087a4545151fc11 src/clerk_backend_api/models/verifyoauthaccesstokenop.py: id: 6a9c59621174 - last_write_checksum: sha1:5d954c025fcf582b78f161acaf25155569c7844a - pristine_git_object: 09c6059cca4583941d26f77edcbd4ae7ca8f0c82 + last_write_checksum: sha1:e9d8bd8f14a3225cdc55595ec515ce71823eeeb8 + pristine_git_object: 3faaae688634e7cc0ab01dff3a18da93ca8f8997 src/clerk_backend_api/models/verifypasswordop.py: id: a40982f96e90 - last_write_checksum: sha1:a0ea93a4ceac4d33d27e058e2d8c6d68cfd9da69 - pristine_git_object: 1254eac55935e64ce75fc56b45af30d23f936fc8 + last_write_checksum: sha1:0318f127b907e82df9f7c99003f64e18f2255526 + pristine_git_object: b63e6b2fd7cf66a68ed5235b9dfc16176682d773 src/clerk_backend_api/models/verifytotpop.py: id: 08100c4346b1 - last_write_checksum: sha1:c3bbd08654498867518968ed664b0acfd6529d46 - pristine_git_object: 1fb852b61837c5b8e4204dbbc0cc37738348aa2d + last_write_checksum: sha1:110b9d39d89aab3f4a33c022d6750cd100f03b0a + pristine_git_object: b69430edeab6c2d780f7281522c3473e19121d7c src/clerk_backend_api/models/waitlistentries.py: id: aeb3f4b8f415 last_write_checksum: sha1:82d606c5dc762c24fdc3099ee54b624ad1a04aa3 pristine_git_object: de1e11be98c4f56cb45cc1b485a66e4e24265c92 src/clerk_backend_api/models/waitlistentry.py: id: da9e10c97ea8 - last_write_checksum: sha1:1cd5062213f3f167657511ef616c1419ec43caa7 - pristine_git_object: 5f807a927c4e2a7a40cbb7e27bd8ab345710c423 + last_write_checksum: sha1:0fa1a86c6287de8218638f9136d21724eae4f704 + pristine_git_object: 81312e5ed12539fc11ff1abc54d58aaa22e91b13 src/clerk_backend_api/models/web3wallet.py: id: 66e5ce51fc85 - last_write_checksum: sha1:ff8b6b53fa5edee51319779f6ad7b9c72ebe6bb4 - pristine_git_object: 4df0fc3d4c1a6c1d37ebec016a546adb5114a68f + last_write_checksum: sha1:3b59dc1eda78fb6364a0ef280fe56956a3bf3a8e + pristine_git_object: 28972a08dd9fa95bb8ecdc79b6477c75e6780f60 src/clerk_backend_api/oauthaccesstokens.py: id: 93363bda547c last_write_checksum: sha1:b8744c98d17bec32be435a02c966a095add8587f @@ -4406,8 +4618,8 @@ trackedFiles: pristine_git_object: 027811c7e3324e6673d873ac12d82caccb85d08e src/clerk_backend_api/organizationinvitations_sdk.py: id: 4ff208f271e3 - last_write_checksum: sha1:76f27bdda34f74718066c0ff71df17aa669a030e - pristine_git_object: a01db51e61f27d80a1d163a7b6c71759ef5c121d + last_write_checksum: sha1:f074386da40de742e0349e33dae3ffb6d88ed55d + pristine_git_object: 13ed5cc077a3c7939d40ad3019eceba1924de692 src/clerk_backend_api/organizationmemberships_sdk.py: id: 1a0c6c4eb892 last_write_checksum: sha1:a4a74108330addda6c9207feedbcd2b4c8b45569 @@ -4422,8 +4634,8 @@ trackedFiles: pristine_git_object: 5d1274bae389462d4245e4cf7bb738187f4a6953 src/clerk_backend_api/organizations_sdk.py: id: bab9dfd5e53d - last_write_checksum: sha1:9c933122a08edfc143d151453b0eb2365e669f21 - pristine_git_object: c83bda8b5547588c3a51799b285a25ec4f5a05cf + last_write_checksum: sha1:d40faeda54736687c03dea23aedde9aea8a7673a + pristine_git_object: 768744ea8329073ef44488f9e855a983c0322368 src/clerk_backend_api/phonenumbers.py: id: 33263264377c last_write_checksum: sha1:062d3ad4e33c2c9474a8a870efc3103ef8a3d1e3 @@ -4450,16 +4662,16 @@ trackedFiles: pristine_git_object: f710592d6a13935db306d88b84d5ef64488dec21 src/clerk_backend_api/sdk.py: id: a4df06d800b5 - last_write_checksum: sha1:9db97f83a439f0301c5de0c0b0b3802564f7879f - pristine_git_object: 61a9f03a32a9b171b7de4f0926654562593478f4 + last_write_checksum: sha1:08137675bbf616e9b8271fd668cbb171c6a7f4b5 + pristine_git_object: 609eb77d1e7c8ea5cf4b4c2dd03ba9cb92060b14 src/clerk_backend_api/sdkconfiguration.py: id: 7e4c691f3b9b last_write_checksum: sha1:da2b3b79da1f6d4669245a6bdd11b20657da25da pristine_git_object: 0ec9fe26aaf37bdd2aceaebf9f0c6fb69f10ecc0 src/clerk_backend_api/sessions.py: id: 170442df3cba - last_write_checksum: sha1:652e791f028b7aeb6b142f099674d1d472b5aa37 - pristine_git_object: e814b63686bf116d720b81ebee5b25fafb6dadac + last_write_checksum: sha1:896808766ab7abf617a62f5a94362d295c892645 + pristine_git_object: 4e044256339e8d43d704c0f9cb750b2bf8b21743 src/clerk_backend_api/signintokens.py: id: 00da479d394d last_write_checksum: sha1:e296a0357fcb0a5367170816840de02d9573f918 @@ -4486,8 +4698,8 @@ trackedFiles: pristine_git_object: a9a640a1a7048736383f96c67c6290c86bf536ee src/clerk_backend_api/users.py: id: 6f835640685a - last_write_checksum: sha1:ec47bbf73f2b47023162655ce3e073af026fd26d - pristine_git_object: a08e4c5f510e1233e49104f6bf4534d37c469d3d + last_write_checksum: sha1:35eee0b6ecb3e0bae65ec41a351ccd1ad73d52cd + pristine_git_object: 08053d459168b323e4a917379b8888816465e20d src/clerk_backend_api/utils/__init__.py: id: a8b67e49e50a last_write_checksum: sha1:1970816f2234ecb8785798240b0edced961de971 @@ -5698,6 +5910,8 @@ examples: application/json: {"object": "organization", "id": "org_123", "name": "Acme Corp", "slug": "acme-corp", "image_url": "https://medium-edge.org", "has_image": false, "members_count": 150, "missing_member_with_elevated_permissions": true, "pending_invitations_count": 950312, "max_allowed_memberships": 300, "admin_delete_enabled": true, "public_metadata": {"public_info": "Info visible to everyone"}, "private_metadata": {"internal_use_only": "Sensitive data"}, "created_by": "user_123456", "created_at": 1625078400, "updated_at": 1625164800, "last_active_at": 914329, "role_set_key": ""} "402": application/json: {"errors": [{"message": "Invalid input", "long_message": "The input provided does not meet the requirements.", "code": "400_bad_request", "meta": {}}], "meta": {}} + "400": + application/json: {"errors": [{"message": "Invalid input", "long_message": "The input provided does not meet the requirements.", "code": "400_bad_request", "meta": {}}], "meta": {}} DeleteOrganization: speakeasy-default-delete-organization: parameters: @@ -6372,7 +6586,7 @@ examples: payer_type: "org" responses: "200": - application/json: {"data": [{"object": "commerce_plan", "id": "", "name": "", "fee": {"amount": 420774, "amount_formatted": "", "currency": "Surinam Dollar", "currency_symbol": "﷼"}, "annual_monthly_fee": {"amount": 401591, "amount_formatted": "", "currency": "Euro", "currency_symbol": "Db"}, "annual_fee": {"amount": 183271, "amount_formatted": "", "currency": "Azerbaijanian Manat", "currency_symbol": "₱"}, "description": "off finally meanwhile tame", "product_id": "", "is_default": false, "is_recurring": false, "publicly_visible": false, "has_base_fee": true, "for_payer_type": "", "slug": "", "avatar_url": "https://enchanted-impostor.com", "features": [], "free_trial_enabled": true, "free_trial_days": 916690}], "total_count": 381334} + application/json: {"data": [{"object": "commerce_plan", "id": "", "name": "", "fee": {"amount": 420774, "amount_formatted": "", "currency": "Surinam Dollar", "currency_symbol": "﷼"}, "annual_monthly_fee": {"amount": 401591, "amount_formatted": "", "currency": "Euro", "currency_symbol": "Db"}, "annual_fee": {"amount": 183271, "amount_formatted": "", "currency": "Azerbaijanian Manat", "currency_symbol": "₱"}, "description": "off finally meanwhile tame", "product_id": "", "is_default": false, "is_recurring": false, "publicly_visible": false, "has_base_fee": true, "for_payer_type": "", "slug": "", "avatar_url": "https://enchanted-impostor.com", "features": [], "free_trial_enabled": true, "free_trial_days": 916690, "unit_prices": [{"name": "", "block_size": 263831, "tiers": [{"starts_at_block": 916690, "ends_after_block": 790434, "fee_per_block": {"amount": 399020, "amount_formatted": "", "currency": "Iranian Rial", "currency_symbol": "€"}}]}]}], "total_count": 381334} "400": application/json: {"errors": [{"message": "Invalid input", "long_message": "The input provided does not meet the requirements.", "code": "400_bad_request", "meta": {}}], "meta": {}} "500": @@ -6380,7 +6594,7 @@ examples: createM2MToken: speakeasy-default-create-m2-M-token: requestBody: - application/json: {"seconds_until_expiration": 9240.85, "claims": ""} + application/json: {"token_format": "opaque", "seconds_until_expiration": 9240.85, "claims": ""} responses: "201": application/json: {"object": "machine_to_machine_token", "id": "mt_f7f0ba8c3b4843ce7d85fcdd5e71853e", "subject": "mch_2xhFjEI5X2qWRvtV13BzSj8H6Dk", "claims": {"important_metadata": "Some useful data"}, "scopes": ["mch_2xhFjEI5X2qWRvtV13BzSj8H6Dk", "mch_2yGkLpQ7Y3rXSwtU24CzTk9I7Em"], "token": "mt_XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX", "revoked": false, "revocation_reason": "Revoked by user", "expired": false, "expiration": 1716883200, "last_used_at": 1716883200, "created_at": 1716883200, "updated_at": 1716883200} @@ -6447,7 +6661,7 @@ examples: organization_id: "" responses: "200": - application/json: {"data": [{"object": "commerce_subscription_item", "id": "", "instance_id": "", "status": "upcoming", "credit": {"amount": {"amount": 115692, "amount_formatted": "", "currency": "Denar", "currency_symbol": "K"}, "cycle_remaining_percent": 5890.09}, "plan_id": "", "price_id": "", "plan": {"object": "commerce_plan", "id": "", "name": "", "fee": {"amount": 349721, "amount_formatted": "", "currency": "Iceland Krona", "currency_symbol": "₪"}, "annual_monthly_fee": {"amount": 500878, "amount_formatted": "", "currency": "Pakistan Rupee", "currency_symbol": "$"}, "annual_fee": {"amount": 13059, "amount_formatted": "", "currency": "Uzbekistan Sum", "currency_symbol": "$"}, "description": "tennis husband meanwhile duh uh-huh chap provided stained wry uncomfortable", "product_id": "", "is_default": false, "is_recurring": true, "publicly_visible": true, "has_base_fee": true, "for_payer_type": "", "slug": "", "avatar_url": "https://monthly-lace.org", "features": [], "free_trial_enabled": true, "free_trial_days": 520556}, "plan_period": "month", "payment_method": {"object": "commerce_payment_method", "id": "", "payer_id": "", "payment_type": "link", "is_default": false, "gateway": "", "gateway_external_id": "", "gateway_external_account_id": "", "last4": "", "status": "disconnected", "wallet_type": "", "card_type": "", "expiry_year": 542201, "expiry_month": 589009, "created_at": 348814, "updated_at": 349721, "is_removable": true}, "lifetime_paid": {"amount": 42923, "amount_formatted": "", "currency": "Swiss Franc", "currency_symbol": "лв"}, "next_payment": null, "payer_id": "", "payer": {"object": "commerce_payer", "id": "", "instance_id": "", "user_id": "", "first_name": "Mathew", "last_name": "McLaughlin", "email": "Zetta_Wilderman39@gmail.com", "organization_id": "", "organization_name": "", "image_url": "https://queasy-charlatan.net/", "credits_balance": {"amount": 724310, "amount_formatted": "", "currency": "Uganda Shilling", "currency_symbol": "$"}, "created_at": 905937, "updated_at": 777337}, "is_free_trial": false, "period_start": 543438, "period_end": 271235, "proration_date": "", "canceled_at": 232920, "past_due_at": null, "ended_at": 743580, "created_at": 762052, "updated_at": 856930}], "total_count": 699308} + application/json: {"data": [{"object": "commerce_subscription_item", "id": "", "instance_id": "", "status": "upcoming", "credit": {"amount": {"amount": 115692, "amount_formatted": "", "currency": "Denar", "currency_symbol": "K"}, "cycle_remaining_percent": 5890.09}, "credits": {"proration": {"amount": {"amount": 760063, "amount_formatted": "", "currency": "Guarani", "currency_symbol": "$"}, "cycle_days_remaining": 754794, "cycle_days_total": 119895, "cycle_remaining_percent": 1156.92}, "payer": {"remaining_balance": {"amount": 989424, "amount_formatted": "", "currency": "Kwacha", "currency_symbol": "L"}, "applied_amount": {"amount": 349721, "amount_formatted": "", "currency": "Iceland Krona", "currency_symbol": "₪"}}, "total": {"amount": 500878, "amount_formatted": "", "currency": "Pakistan Rupee", "currency_symbol": "$"}}, "plan_id": "", "price_id": "", "plan": {"object": "commerce_plan", "id": "", "name": "", "fee": {"amount": 349721, "amount_formatted": "", "currency": "Iceland Krona", "currency_symbol": "₪"}, "annual_monthly_fee": {"amount": 500878, "amount_formatted": "", "currency": "Pakistan Rupee", "currency_symbol": "$"}, "annual_fee": {"amount": 13059, "amount_formatted": "", "currency": "Uzbekistan Sum", "currency_symbol": "$"}, "description": "tennis husband meanwhile duh uh-huh chap provided stained wry uncomfortable", "product_id": "", "is_default": false, "is_recurring": true, "publicly_visible": true, "has_base_fee": true, "for_payer_type": "", "slug": "", "avatar_url": "https://monthly-lace.org", "features": [], "free_trial_enabled": true, "free_trial_days": 520556, "unit_prices": [{"name": "", "block_size": 13059, "tiers": [{"starts_at_block": 339643, "ends_after_block": 790012, "fee_per_block": {"amount": 676339, "amount_formatted": "", "currency": "Sudanese Pound", "currency_symbol": "£"}}]}]}, "plan_period": "month", "payment_method": {"object": "commerce_payment_method", "id": "", "payer_id": "", "payment_type": "link", "is_default": false, "gateway": "", "gateway_external_id": "", "gateway_external_account_id": "", "last4": "", "status": "disconnected", "wallet_type": "", "card_type": "", "expiry_year": 542201, "expiry_month": 589009, "created_at": 348814, "updated_at": 349721, "is_removable": true}, "lifetime_paid": {"amount": 42923, "amount_formatted": "", "currency": "Swiss Franc", "currency_symbol": "лв"}, "next_payment": null, "payer_id": "", "payer": {"object": "commerce_payer", "id": "", "instance_id": "", "user_id": "", "first_name": "Mathew", "last_name": "McLaughlin", "email": "Zetta_Wilderman39@gmail.com", "organization_id": "", "organization_name": "", "image_url": "https://queasy-charlatan.net/", "credits_balance": {"amount": 724310, "amount_formatted": "", "currency": "Uganda Shilling", "currency_symbol": "$"}, "created_at": 905937, "updated_at": 777337}, "is_free_trial": false, "period_start": 543438, "period_end": 271235, "proration_date": "", "canceled_at": 232920, "past_due_at": null, "ended_at": 743580, "created_at": 762052, "updated_at": 856930, "seats": {"quantity": 562691}, "totals": {"subtotal": {"amount": 242637, "amount_formatted": "", "currency": "Solomon Islands Dollar", "currency_symbol": "﷼"}, "base_fee": {"amount": 380056, "amount_formatted": "", "currency": "Peso Uruguayo", "currency_symbol": "S"}, "tax_total": {"amount": 91855, "amount_formatted": "", "currency": "Riel", "currency_symbol": "Lek"}, "grand_total": {"amount": 82013, "amount_formatted": "", "currency": "Czech Koruna", "currency_symbol": "$"}, "per_unit_totals": [{"name": "", "block_size": 422219, "tiers": []}], "credits": {"proration": {"amount": {"amount": 760063, "amount_formatted": "", "currency": "Guarani", "currency_symbol": "$"}, "cycle_days_remaining": 71270, "cycle_days_total": 126213, "cycle_remaining_percent": 1879.2}, "payer": {"remaining_balance": {"amount": 989424, "amount_formatted": "", "currency": "Kwacha", "currency_symbol": "L"}, "applied_amount": {"amount": 349721, "amount_formatted": "", "currency": "Iceland Krona", "currency_symbol": "₪"}}, "total": {"amount": 500878, "amount_formatted": "", "currency": "Pakistan Rupee", "currency_symbol": "$"}}}}], "total_count": 699308} "400": application/json: {"errors": [{"message": "Invalid input", "long_message": "The input provided does not meet the requirements.", "code": "400_bad_request", "meta": {}}], "meta": {}} "500": @@ -6471,7 +6685,7 @@ examples: organization_id: "" responses: "200": - application/json: {"object": "commerce_subscription", "id": "", "instance_id": "", "status": "abandoned", "payer_id": "", "created_at": 867059, "updated_at": 35040, "active_at": 916886, "past_due_at": 317090, "subscription_items": [{"object": "commerce_subscription_item", "id": "", "instance_id": "", "status": "past_due", "credit": {"amount": {"amount": 24678, "amount_formatted": "", "currency": "Balboa", "currency_symbol": "ман"}, "cycle_remaining_percent": 8943.6}, "plan_id": "", "price_id": "", "plan": {"object": "commerce_plan", "id": "", "name": "", "fee": {"amount": 628116, "amount_formatted": "", "currency": "Djibouti Franc", "currency_symbol": "лв"}, "annual_monthly_fee": {"amount": 152879, "amount_formatted": "", "currency": "Bhutanese Ngultrum", "currency_symbol": "₫"}, "annual_fee": {"amount": 475807, "amount_formatted": "", "currency": "Kip", "currency_symbol": "BZ$"}, "description": "whoever geez whoever sparse tabletop versus", "product_id": "", "is_default": false, "is_recurring": false, "publicly_visible": true, "has_base_fee": true, "for_payer_type": "", "slug": "", "avatar_url": "https://sour-trick.com", "features": [], "free_trial_enabled": false, "free_trial_days": 780011}, "plan_period": "annual", "payment_method": {"object": "commerce_payment_method", "id": "", "payer_id": "", "payment_type": "link", "is_default": false, "gateway": "", "gateway_external_id": "", "gateway_external_account_id": null, "last4": "", "status": "disconnected", "wallet_type": "", "card_type": "", "expiry_year": 360368, "expiry_month": 313834, "created_at": 24678, "updated_at": 651973, "is_removable": true}, "lifetime_paid": {"amount": 770015, "amount_formatted": "", "currency": "Mauritius Rupee", "currency_symbol": "ƒ"}, "next_payment": {"amount": null, "date": 312699}, "payer_id": "", "payer": {"object": "commerce_payer", "id": "", "instance_id": "", "user_id": "", "first_name": "Tabitha", "last_name": "Welch", "email": "Maxie.Cremin95@yahoo.com", "organization_id": "", "organization_name": "", "image_url": "https://shameful-newsstand.name/", "credits_balance": {"amount": 721500, "amount_formatted": "", "currency": "New Taiwan Dollar", "currency_symbol": "J$"}, "created_at": 787220, "updated_at": 724781}, "is_free_trial": true, "period_start": 856116, "period_end": 857283, "proration_date": "", "canceled_at": 151137, "past_due_at": 503945, "ended_at": 94519, "created_at": 484361, "updated_at": 191350}], "next_payment": {"date": 223172, "amount": {"amount": 254347, "amount_formatted": "", "currency": "Bermudian Dollar (customarily known as Bermuda Dollar)", "currency_symbol": "Bs"}}, "eligible_for_free_trial": false} + application/json: {"object": "commerce_subscription", "id": "", "instance_id": "", "status": "abandoned", "payer_id": "", "created_at": 867059, "updated_at": 35040, "active_at": 916886, "past_due_at": 317090, "subscription_items": [{"object": "commerce_subscription_item", "id": "", "instance_id": "", "status": "past_due", "credit": {"amount": {"amount": 24678, "amount_formatted": "", "currency": "Balboa", "currency_symbol": "ман"}, "cycle_remaining_percent": 8943.6}, "credits": {"proration": {"amount": {"amount": 35040, "amount_formatted": "", "currency": "Jamaican Dollar", "currency_symbol": "₫"}, "cycle_days_remaining": 644506, "cycle_days_total": 317090, "cycle_remaining_percent": 7770.48}, "payer": {"remaining_balance": {"amount": 865397, "amount_formatted": "", "currency": "Dalasi", "currency_symbol": "B/."}, "applied_amount": {"amount": 58513, "amount_formatted": "", "currency": "US Dollar", "currency_symbol": "kr"}}, "total": {"amount": 226768, "amount_formatted": "", "currency": "Som", "currency_symbol": "BZ$"}}, "plan_id": "", "price_id": "", "plan": {"object": "commerce_plan", "id": "", "name": "", "fee": {"amount": 628116, "amount_formatted": "", "currency": "Djibouti Franc", "currency_symbol": "лв"}, "annual_monthly_fee": {"amount": 152879, "amount_formatted": "", "currency": "Bhutanese Ngultrum", "currency_symbol": "₫"}, "annual_fee": {"amount": 475807, "amount_formatted": "", "currency": "Kip", "currency_symbol": "BZ$"}, "description": "whoever geez whoever sparse tabletop versus", "product_id": "", "is_default": false, "is_recurring": false, "publicly_visible": true, "has_base_fee": true, "for_payer_type": "", "slug": "", "avatar_url": "https://sour-trick.com", "features": [], "free_trial_enabled": false, "free_trial_days": 780011, "unit_prices": [{"name": "", "block_size": 377624, "tiers": [{"starts_at_block": 916671, "ends_after_block": 491606, "fee_per_block": {"amount": 312838, "amount_formatted": "", "currency": "Belize Dollar", "currency_symbol": "Bs"}}]}]}, "plan_period": "annual", "payment_method": {"object": "commerce_payment_method", "id": "", "payer_id": "", "payment_type": "link", "is_default": false, "gateway": "", "gateway_external_id": "", "gateway_external_account_id": null, "last4": "", "status": "disconnected", "wallet_type": "", "card_type": "", "expiry_year": 360368, "expiry_month": 313834, "created_at": 24678, "updated_at": 651973, "is_removable": true}, "lifetime_paid": {"amount": 770015, "amount_formatted": "", "currency": "Mauritius Rupee", "currency_symbol": "ƒ"}, "next_payment": {"amount": null, "date": 312699}, "payer_id": "", "payer": {"object": "commerce_payer", "id": "", "instance_id": "", "user_id": "", "first_name": "Tabitha", "last_name": "Welch", "email": "Maxie.Cremin95@yahoo.com", "organization_id": "", "organization_name": "", "image_url": "https://shameful-newsstand.name/", "credits_balance": {"amount": 721500, "amount_formatted": "", "currency": "New Taiwan Dollar", "currency_symbol": "J$"}, "created_at": 787220, "updated_at": 724781}, "is_free_trial": true, "period_start": 856116, "period_end": 857283, "proration_date": "", "canceled_at": 151137, "past_due_at": 503945, "ended_at": 94519, "created_at": 484361, "updated_at": 191350, "seats": {"quantity": 541570}, "totals": {"subtotal": {"amount": 457517, "amount_formatted": "", "currency": "Belize Dollar", "currency_symbol": "Q"}, "base_fee": {"amount": 111328, "amount_formatted": "", "currency": "Lek", "currency_symbol": "TT$"}, "tax_total": {"amount": 922221, "amount_formatted": "", "currency": "CFP Franc", "currency_symbol": "₩"}, "grand_total": {"amount": 272043, "amount_formatted": "", "currency": "Vatu", "currency_symbol": "kr"}, "per_unit_totals": [{"name": "", "block_size": 62572, "tiers": [{"quantity": 10191, "fee_per_block": {"amount": 312838, "amount_formatted": "", "currency": "Belize Dollar", "currency_symbol": "Bs"}, "total": {"amount": 226768, "amount_formatted": "", "currency": "Som", "currency_symbol": "BZ$"}}]}], "credits": null}}], "next_payment": {"date": 223172, "amount": {"amount": 35040, "amount_formatted": "", "currency": "Jamaican Dollar", "currency_symbol": "₫"}}, "eligible_for_free_trial": false} "400": application/json: {"errors": [{"message": "Invalid input", "long_message": "The input provided does not meet the requirements.", "code": "400_bad_request", "meta": {}}], "meta": {}} "500": @@ -6507,7 +6721,7 @@ examples: end_now: false responses: "200": - application/json: {"object": "commerce_subscription_item", "id": "", "instance_id": "", "status": "abandoned", "credit": {"amount": {"amount": 595314, "amount_formatted": "", "currency": "Balboa", "currency_symbol": "C$"}, "cycle_remaining_percent": 4623.13}, "plan_id": "", "price_id": "", "plan": null, "plan_period": "annual", "payment_method": {"object": "commerce_payment_method", "id": "", "payer_id": "", "payment_type": "link", "is_default": false, "gateway": "", "gateway_external_id": "", "gateway_external_account_id": "", "last4": "", "status": "disconnected", "wallet_type": "", "card_type": "", "expiry_year": 16342, "expiry_month": 842294, "created_at": 526434, "updated_at": 344897, "is_removable": false}, "lifetime_paid": {"amount": 333252, "amount_formatted": "", "currency": "New Israeli Sheqel", "currency_symbol": "₨"}, "next_payment": {"amount": {"amount": 967195, "amount_formatted": "", "currency": "Lilangeni", "currency_symbol": "kr"}, "date": 191144}, "payer_id": "", "payer": {"object": "commerce_payer", "id": "", "instance_id": "", "user_id": "", "first_name": "Valentina", "last_name": null, "email": "Vickie.Wolf@gmail.com", "organization_id": "", "organization_name": "", "image_url": "https://bad-grandpa.name/", "credits_balance": {"amount": 963236, "amount_formatted": "", "currency": "US Dollar", "currency_symbol": "$"}, "created_at": 163690, "updated_at": 892368}, "is_free_trial": true, "period_start": 307393, "period_end": 617624, "proration_date": "", "canceled_at": 479144, "past_due_at": 889815, "ended_at": 879881, "created_at": 858429, "updated_at": 224059} + application/json: {"object": "commerce_subscription_item", "id": "", "instance_id": "", "status": "abandoned", "credit": {"amount": {"amount": 595314, "amount_formatted": "", "currency": "Balboa", "currency_symbol": "C$"}, "cycle_remaining_percent": 4623.13}, "credits": {"proration": {"amount": {"amount": 106392, "amount_formatted": "", "currency": "Mexican Peso", "currency_symbol": "B/."}, "cycle_days_remaining": 662779, "cycle_days_total": 621775, "cycle_remaining_percent": 4623.13}, "payer": null, "total": {"amount": 512558, "amount_formatted": "", "currency": "Tunisian Dinar", "currency_symbol": "L"}}, "plan_id": "", "price_id": "", "plan": null, "plan_period": "annual", "payment_method": {"object": "commerce_payment_method", "id": "", "payer_id": "", "payment_type": "link", "is_default": false, "gateway": "", "gateway_external_id": "", "gateway_external_account_id": "", "last4": "", "status": "disconnected", "wallet_type": "", "card_type": "", "expiry_year": 16342, "expiry_month": 842294, "created_at": 526434, "updated_at": 344897, "is_removable": false}, "lifetime_paid": {"amount": 333252, "amount_formatted": "", "currency": "New Israeli Sheqel", "currency_symbol": "₨"}, "next_payment": {"amount": {"amount": 967195, "amount_formatted": "", "currency": "Lilangeni", "currency_symbol": "kr"}, "date": 191144}, "payer_id": "", "payer": {"object": "commerce_payer", "id": "", "instance_id": "", "user_id": "", "first_name": "Valentina", "last_name": null, "email": "Vickie.Wolf@gmail.com", "organization_id": "", "organization_name": "", "image_url": "https://bad-grandpa.name/", "credits_balance": {"amount": 963236, "amount_formatted": "", "currency": "US Dollar", "currency_symbol": "$"}, "created_at": 163690, "updated_at": 892368}, "is_free_trial": true, "period_start": 307393, "period_end": 617624, "proration_date": "", "canceled_at": 479144, "past_due_at": 889815, "ended_at": 879881, "created_at": 858429, "updated_at": 224059, "seats": {"quantity": 638223}, "totals": {"subtotal": {"amount": 99889, "amount_formatted": "", "currency": "Uganda Shilling", "currency_symbol": "¥"}, "base_fee": {"amount": 960093, "amount_formatted": "", "currency": "Solomon Islands Dollar", "currency_symbol": "$"}, "tax_total": {"amount": 370856, "amount_formatted": "", "currency": "Nepalese Rupee", "currency_symbol": "₩"}, "grand_total": {"amount": 200777, "amount_formatted": "", "currency": "Aruban Guilder", "currency_symbol": "$"}, "per_unit_totals": [{"name": "", "block_size": 417629, "tiers": []}], "credits": {"proration": {"amount": {"amount": 106392, "amount_formatted": "", "currency": "Mexican Peso", "currency_symbol": "B/."}, "cycle_days_remaining": 438584, "cycle_days_total": 415615, "cycle_remaining_percent": 9671.95}, "payer": {"remaining_balance": {"amount": 624208, "amount_formatted": "", "currency": "Leone", "currency_symbol": "$"}, "applied_amount": {"amount": 81467, "amount_formatted": "", "currency": "Colombian Peso", "currency_symbol": "lei"}}, "total": {"amount": 512558, "amount_formatted": "", "currency": "Tunisian Dinar", "currency_symbol": "L"}}}} "400": application/json: {"errors": [{"message": "Invalid input", "long_message": "The input provided does not meet the requirements.", "code": "400_bad_request", "meta": {}}], "meta": {}} "500": @@ -6583,7 +6797,7 @@ examples: statementID: "" responses: "200": - application/json: {"object": "commerce_statement", "id": "", "instance_id": "", "timestamp": 21343, "payer": {"object": "commerce_payer", "id": "", "instance_id": "", "user_id": "", "first_name": "Roberto", "last_name": "Hauck", "email": null, "organization_id": null, "organization_name": "", "image_url": "https://ultimate-toothpick.info/", "credits_balance": {"amount": 21343, "amount_formatted": "", "currency": "New Leu", "currency_symbol": "MT"}, "created_at": 362296, "updated_at": 427838}, "status": "closed", "totals": {"grand_total": {"amount": 350201, "amount_formatted": "", "currency": "Zimbabwe Dollar", "currency_symbol": "₱"}, "subtotal": {"amount": 887383, "amount_formatted": "", "currency": "Bermudian Dollar (customarily known as Bermuda Dollar)", "currency_symbol": "$"}, "tax_total": {"amount": 370266, "amount_formatted": "", "currency": "Nuevo Sol", "currency_symbol": "Db"}}, "groups": []} + application/json: {"object": "commerce_statement", "id": "", "instance_id": "", "timestamp": 21343, "payer": {"object": "commerce_payer", "id": "", "instance_id": "", "user_id": "", "first_name": "Roberto", "last_name": "Hauck", "email": null, "organization_id": null, "organization_name": "", "image_url": "https://ultimate-toothpick.info/", "credits_balance": {"amount": 21343, "amount_formatted": "", "currency": "New Leu", "currency_symbol": "MT"}, "created_at": 362296, "updated_at": 427838}, "status": "closed", "totals": {"grand_total": {"amount": 350201, "amount_formatted": "", "currency": "Zimbabwe Dollar", "currency_symbol": "₱"}, "subtotal": {"amount": 887383, "amount_formatted": "", "currency": "Bermudian Dollar (customarily known as Bermuda Dollar)", "currency_symbol": "$"}, "base_fee": {"amount": 21343, "amount_formatted": "", "currency": "New Leu", "currency_symbol": "MT"}, "tax_total": {"amount": 370266, "amount_formatted": "", "currency": "Nuevo Sol", "currency_symbol": "Db"}}, "groups": []} "400": application/json: {"errors": [{"message": "Invalid input", "long_message": "The input provided does not meet the requirements.", "code": "400_bad_request", "meta": {}}], "meta": {}} "500": @@ -6903,7 +7117,7 @@ examples: application/json: {"plan_id": "", "currency": "USD", "amount": 826545, "annual_monthly_amount": 565484, "description": "why whoa remarkable properly freely at creative following inspect woot"} responses: "200": - application/json: {"object": "commerce_price", "id": "", "plan_id": "", "instance_id": "", "currency": "Kenyan Shilling", "currency_symbol": "Bs", "amount": 750680, "annual_monthly_amount": 982885, "fee": {"amount": 105361, "amount_formatted": "", "currency": "Jordanian Dinar", "currency_symbol": "$"}, "annual_monthly_fee": {"amount": 873065, "amount_formatted": "", "currency": "Qatari Rial", "currency_symbol": "лв"}, "description": "ah mousse an", "created_at": 399221} + application/json: {"object": "commerce_price", "id": "", "plan_id": "", "instance_id": "", "currency": "Kenyan Shilling", "currency_symbol": "Bs", "amount": 750680, "annual_monthly_amount": 982885, "fee": {"amount": 105361, "amount_formatted": "", "currency": "Jordanian Dinar", "currency_symbol": "$"}, "annual_monthly_fee": {"amount": 873065, "amount_formatted": "", "currency": "Qatari Rial", "currency_symbol": "лв"}, "description": "ah mousse an", "is_default": false, "created_at": 399221} "400": application/json: {"errors": [{"message": "Invalid input", "long_message": "The input provided does not meet the requirements.", "code": "400_bad_request", "meta": {}}], "meta": {}} "500": @@ -6917,7 +7131,7 @@ examples: application/json: {"from_price_id": "", "to_price_id": ""} responses: "200": - application/json: {"object": "commerce_price_transition", "subscription_item": {"object": "commerce_subscription_item", "id": "", "instance_id": "", "status": "past_due", "credit": {"amount": {"amount": 510709, "amount_formatted": "", "currency": "Cayman Islands Dollar", "currency_symbol": "$"}, "cycle_remaining_percent": 2872.34}, "plan_id": "", "price_id": "", "plan": {"object": "commerce_plan", "id": "", "name": "", "fee": {"amount": 798728, "amount_formatted": "", "currency": "Egyptian Pound", "currency_symbol": "Nu"}, "annual_monthly_fee": {"amount": 290472, "amount_formatted": "", "currency": "Burundi Franc", "currency_symbol": "₨"}, "annual_fee": {"amount": 93690, "amount_formatted": "", "currency": "Cordoba Oro", "currency_symbol": "kr"}, "amount": 21711, "amount_formatted": "", "annual_monthly_amount": 759359, "annual_monthly_amount_formatted": "", "annual_amount": 288916, "annual_amount_formatted": "", "currency_symbol": "₨", "currency": "Tugrik", "description": "strictly if uncommon somber round on ferociously fraudster", "product_id": "", "is_default": true, "is_recurring": false, "publicly_visible": true, "has_base_fee": true, "payer_type": ["", ""], "for_payer_type": "", "slug": "", "avatar_url": "https://classic-cannon.biz/", "period": "", "interval": 536229, "features": [], "free_trial_enabled": true, "free_trial_days": 595614}, "plan_period": "month", "payment_source_id": "", "payment_source": {"object": "commerce_source", "id": "", "payer_id": "", "payment_method": "google_pay", "is_default": null, "gateway": "", "gateway_external_id": "", "gateway_external_account_id": "", "last4": "", "status": "active", "wallet_type": "", "card_type": "", "expiry_year": 464942, "expiry_month": 125425, "created_at": 70243, "updated_at": 164594, "is_removable": false}, "lifetime_paid": {"amount": 441095, "amount_formatted": "", "currency": "Venezuelan bolívar", "currency_symbol": "CHF"}, "amount": {"amount": 689174, "amount_formatted": "", "currency": "Iranian Rial", "currency_symbol": "S"}, "next_invoice": {"amount": {"amount": 487368, "amount_formatted": "", "currency": "Boliviano boliviano", "currency_symbol": "zł"}, "date": 759284}, "next_payment": {"amount": {"amount": 978224, "amount_formatted": "", "currency": "Gourde", "currency_symbol": "£"}, "date": 473256}, "payer_id": "", "payer": {"object": "commerce_payer", "id": "", "instance_id": "", "user_id": "", "first_name": "Ismael", "last_name": "Medhurst", "email": "Ova.Mraz67@hotmail.com", "organization_id": "", "organization_name": "", "image_url": "https://utter-fowl.biz/", "credits_balance": {"amount": 476886, "amount_formatted": "", "currency": "Quetzal", "currency_symbol": "₨"}, "created_at": 671201, "updated_at": 567156}, "is_free_trial": true, "period_start": 659204, "period_end": 575036, "proration_date": "", "canceled_at": 820502, "past_due_at": 293989, "ended_at": 189628, "created_at": 804154, "updated_at": 821030}, "transition": {"previous_plan": {"object": "commerce_plan", "id": "", "name": "", "fee": {"amount": 798728, "amount_formatted": "", "currency": "Egyptian Pound", "currency_symbol": "Nu"}, "annual_monthly_fee": {"amount": 290472, "amount_formatted": "", "currency": "Burundi Franc", "currency_symbol": "₨"}, "annual_fee": {"amount": 93690, "amount_formatted": "", "currency": "Cordoba Oro", "currency_symbol": "kr"}, "amount": 183032, "amount_formatted": "", "annual_monthly_amount": 162899, "annual_monthly_amount_formatted": "", "annual_amount": 855406, "annual_amount_formatted": "", "currency_symbol": "kr", "currency": "Zimbabwe Dollar", "description": "piglet carpool ha unaccountably rich carelessly meh voluntarily", "product_id": "", "is_default": false, "is_recurring": false, "publicly_visible": true, "has_base_fee": true, "payer_type": [""], "for_payer_type": "", "slug": "", "avatar_url": "https://torn-yin.net/", "period": "", "interval": 111904, "features": [{"object": "feature", "id": "", "name": "", "description": "qua progress times alongside pliers", "slug": "", "avatar_url": "https://frizzy-decongestant.com/"}], "free_trial_enabled": true, "free_trial_days": 448853}, "previous_price": {"object": "commerce_price", "id": "", "plan_id": "", "instance_id": "", "currency": "Ouguiya", "currency_symbol": "£", "amount": 186921, "annual_monthly_amount": 178047, "fee": {"amount": 798728, "amount_formatted": "", "currency": "Egyptian Pound", "currency_symbol": "Nu"}, "annual_monthly_fee": {"amount": 290472, "amount_formatted": "", "currency": "Burundi Franc", "currency_symbol": "₨"}, "description": "boldly yearly trouser", "created_at": 750571}, "effective_at": 750041, "effective_mode": "immediate", "next_billing_date": 198923, "charged_immediately": true, "immediate_charge": {"amount": 70077, "amount_formatted": "", "currency": "CFP Franc", "currency_symbol": "TT$"}, "previous_subscription_item_status": "abandoned", "previous_subscription_item_id": ""}} + application/json: {"object": "commerce_price_transition", "subscription_item": {"object": "commerce_subscription_item", "id": "", "instance_id": "", "status": "past_due", "credit": {"amount": {"amount": 510709, "amount_formatted": "", "currency": "Cayman Islands Dollar", "currency_symbol": "$"}, "cycle_remaining_percent": 2872.34}, "plan_id": "", "price_id": "", "plan": {"object": "commerce_plan", "id": "", "name": "", "fee": {"amount": 798728, "amount_formatted": "", "currency": "Egyptian Pound", "currency_symbol": "Nu"}, "annual_monthly_fee": {"amount": 290472, "amount_formatted": "", "currency": "Burundi Franc", "currency_symbol": "₨"}, "annual_fee": {"amount": 93690, "amount_formatted": "", "currency": "Cordoba Oro", "currency_symbol": "kr"}, "amount": 21711, "amount_formatted": "", "annual_monthly_amount": 759359, "annual_monthly_amount_formatted": "", "annual_amount": 288916, "annual_amount_formatted": "", "currency_symbol": "₨", "currency": "Tugrik", "description": "strictly if uncommon somber round on ferociously fraudster", "product_id": "", "is_default": true, "is_recurring": false, "publicly_visible": true, "has_base_fee": true, "payer_type": ["", ""], "for_payer_type": "", "slug": "", "avatar_url": "https://classic-cannon.biz/", "period": "", "interval": 536229, "features": [], "free_trial_enabled": true, "free_trial_days": 595614}, "plan_period": "month", "payment_source_id": "", "payment_source": {"object": "commerce_source", "id": "", "payer_id": "", "payment_method": "google_pay", "is_default": null, "gateway": "", "gateway_external_id": "", "gateway_external_account_id": "", "last4": "", "status": "active", "wallet_type": "", "card_type": "", "expiry_year": 464942, "expiry_month": 125425, "created_at": 70243, "updated_at": 164594, "is_removable": false}, "lifetime_paid": {"amount": 441095, "amount_formatted": "", "currency": "Venezuelan bolívar", "currency_symbol": "CHF"}, "amount": {"amount": 689174, "amount_formatted": "", "currency": "Iranian Rial", "currency_symbol": "S"}, "next_invoice": {"amount": {"amount": 487368, "amount_formatted": "", "currency": "Boliviano boliviano", "currency_symbol": "zł"}, "date": 759284}, "next_payment": {"amount": {"amount": 978224, "amount_formatted": "", "currency": "Gourde", "currency_symbol": "£"}, "date": 473256}, "payer_id": "", "payer": {"object": "commerce_payer", "id": "", "instance_id": "", "user_id": "", "first_name": "Ismael", "last_name": "Medhurst", "email": "Ova.Mraz67@hotmail.com", "organization_id": "", "organization_name": "", "image_url": "https://utter-fowl.biz/", "credits_balance": {"amount": 476886, "amount_formatted": "", "currency": "Quetzal", "currency_symbol": "₨"}, "created_at": 671201, "updated_at": 567156}, "is_free_trial": true, "period_start": 659204, "period_end": 575036, "proration_date": "", "canceled_at": 820502, "past_due_at": 293989, "ended_at": 189628, "created_at": 804154, "updated_at": 821030}, "transition": {"previous_plan": {"object": "commerce_plan", "id": "", "name": "", "fee": {"amount": 798728, "amount_formatted": "", "currency": "Egyptian Pound", "currency_symbol": "Nu"}, "annual_monthly_fee": {"amount": 290472, "amount_formatted": "", "currency": "Burundi Franc", "currency_symbol": "₨"}, "annual_fee": {"amount": 93690, "amount_formatted": "", "currency": "Cordoba Oro", "currency_symbol": "kr"}, "amount": 183032, "amount_formatted": "", "annual_monthly_amount": 162899, "annual_monthly_amount_formatted": "", "annual_amount": 855406, "annual_amount_formatted": "", "currency_symbol": "kr", "currency": "Zimbabwe Dollar", "description": "piglet carpool ha unaccountably rich carelessly meh voluntarily", "product_id": "", "is_default": false, "is_recurring": false, "publicly_visible": true, "has_base_fee": true, "payer_type": [""], "for_payer_type": "", "slug": "", "avatar_url": "https://torn-yin.net/", "period": "", "interval": 111904, "features": [{"object": "feature", "id": "", "name": "", "description": "qua progress times alongside pliers", "slug": "", "avatar_url": "https://frizzy-decongestant.com/"}], "free_trial_enabled": true, "free_trial_days": 448853}, "previous_price": {"object": "commerce_price", "id": "", "plan_id": "", "instance_id": "", "currency": "Ouguiya", "currency_symbol": "£", "amount": 186921, "annual_monthly_amount": 178047, "fee": {"amount": 798728, "amount_formatted": "", "currency": "Egyptian Pound", "currency_symbol": "Nu"}, "annual_monthly_fee": {"amount": 290472, "amount_formatted": "", "currency": "Burundi Franc", "currency_symbol": "₨"}, "description": "boldly yearly trouser", "is_default": true, "created_at": 750571}, "effective_at": 750041, "effective_mode": "immediate", "next_billing_date": 198923, "charged_immediately": true, "immediate_charge": {"amount": 70077, "amount_formatted": "", "currency": "CFP Franc", "currency_symbol": "TT$"}, "previous_subscription_item_status": "abandoned", "previous_subscription_item_id": ""}} "400": application/json: {"errors": [{"message": "Invalid input", "long_message": "The input provided does not meet the requirements.", "code": "400_bad_request", "meta": {}}], "meta": {}} "500": @@ -7002,8 +7216,123 @@ examples: application/json: {"object": "role_set", "id": "", "name": "", "key": "", "description": "lustrous notwithstanding hold questioningly", "roles": [{"object": "role_set_item", "id": "", "name": "", "key": "", "description": "wearily even fishery refine small", "members_count": 324369, "has_members": false, "created_at": 512210, "updated_at": 77989}], "default_role": {"object": "role_set_item", "id": "", "name": "", "key": "", "description": "than than why er circa quantify sense", "members_count": 193035, "has_members": null, "created_at": 728836, "updated_at": 255134}, "creator_role": {"object": "role_set_item", "id": "", "name": "", "key": "", "description": "detain underneath huzzah lounge oval by minty mmm astride", "members_count": 3600, "has_members": true, "created_at": 773354, "updated_at": 97332}, "type": "custom", "role_set_migration": {"object": "role_set_migration", "id": "", "organization_id": "", "instance_id": "", "source_role_set_id": "", "dest_role_set_id": "", "trigger_type": "", "status": "", "migrated_members": 587651, "mappings": {"key": "", "key1": "", "key2": ""}, "started_at": 497298, "completed_at": 979505, "created_at": 32098, "updated_at": 686117}, "created_at": 650880, "updated_at": 871456} "400": application/json: {"errors": [{"message": "Invalid input", "long_message": "The input provided does not meet the requirements.", "code": "400_bad_request", "meta": {}}], "meta": {}} + GetUserBillingCreditBalance: + speakeasy-default-get-user-billing-credit-balance: + parameters: + path: + user_id: "" + responses: + "200": + application/json: {"object": "", "balance": {"amount": 218567, "amount_formatted": "", "currency": "CFA Franc BEAC", "currency_symbol": "₱"}} + "400": + application/json: {"errors": [{"message": "Invalid input", "long_message": "The input provided does not meet the requirements.", "code": "400_bad_request", "meta": {}}], "meta": {}} + "500": + application/json: {"errors": [{"message": "Invalid input", "long_message": "The input provided does not meet the requirements.", "code": "400_bad_request", "meta": {}}], "meta": {}} + AdjustUserBillingCreditBalance: + speakeasy-default-adjust-user-billing-credit-balance: + parameters: + path: + user_id: "" + requestBody: + application/json: {"amount": 562473, "action": "decrease", "currency": "New Israeli Sheqel", "idempotency_key": "", "note": ""} + responses: + "200": + application/json: {"object": "", "id": "", "payer_id": "", "amount": 222674, "currency": "Taka", "source_type": "", "source_id": "", "note": "", "created_at": "2025-01-09T02:47:24.664Z"} + "400": + application/json: {"errors": [{"message": "Invalid input", "long_message": "The input provided does not meet the requirements.", "code": "400_bad_request", "meta": {}}], "meta": {}} + "500": + application/json: {"errors": [{"message": "Invalid input", "long_message": "The input provided does not meet the requirements.", "code": "400_bad_request", "meta": {}}], "meta": {}} + GetInstanceOAuthApplicationSettings: + speakeasy-default-get-instance-O-auth-application-settings: + responses: + "200": + application/json: {"object": "oauth_application_settings", "dynamic_oauth_client_registration": false, "oauth_jwt_access_tokens": false} + UpdateInstanceOAuthApplicationSettings: + speakeasy-default-update-instance-O-auth-application-settings: + requestBody: + application/json: {"dynamic_oauth_client_registration": false, "oauth_jwt_access_tokens": true} + responses: + "200": + application/json: {"object": "oauth_application_settings", "dynamic_oauth_client_registration": false, "oauth_jwt_access_tokens": false} + "422": + application/json: {"errors": [{"message": "Invalid input", "long_message": "The input provided does not meet the requirements.", "code": "400_bad_request", "meta": {}}], "meta": {}} + GetOrganizationBillingCreditBalance: + speakeasy-default-get-organization-billing-credit-balance: + parameters: + path: + organization_id: "" + responses: + "200": + application/json: {"object": "", "balance": {"amount": 479152, "amount_formatted": "", "currency": "Lebanese Pound", "currency_symbol": "L"}} + "400": + application/json: {"errors": [{"message": "Invalid input", "long_message": "The input provided does not meet the requirements.", "code": "400_bad_request", "meta": {}}], "meta": {}} + "500": + application/json: {"errors": [{"message": "Invalid input", "long_message": "The input provided does not meet the requirements.", "code": "400_bad_request", "meta": {}}], "meta": {}} + AdjustOrganizationBillingCreditBalance: + speakeasy-default-adjust-organization-billing-credit-balance: + parameters: + path: + organization_id: "" + requestBody: + application/json: {"amount": 245081, "action": "increase", "currency": "Seychelles Rupee", "idempotency_key": "", "note": ""} + responses: + "200": + application/json: {"object": "", "id": "", "payer_id": "", "amount": 339788, "currency": "Pula", "source_type": "", "source_id": "", "note": "", "created_at": "2026-12-21T09:35:45.893Z"} + "400": + application/json: {"errors": [{"message": "Invalid input", "long_message": "The input provided does not meet the requirements.", "code": "400_bad_request", "meta": {}}], "meta": {}} + "500": + application/json: {"errors": [{"message": "Invalid input", "long_message": "The input provided does not meet the requirements.", "code": "400_bad_request", "meta": {}}], "meta": {}} + CreateAgentTask: + speakeasy-default-create-agent-task: + requestBody: + application/json: {"on_behalf_of": {"user_id": "", "identifier": ""}, "permissions": "*", "agent_name": "", "task_description": "", "redirect_url": "https://brilliant-typewriter.net", "session_max_duration_in_seconds": 1800} + responses: + "200": + application/json: {"object": "agent_task", "agent_id": "", "task_id": "", "url": "https://heavy-completion.net"} + "400": + application/json: {"errors": [{"message": "Invalid input", "long_message": "The input provided does not meet the requirements.", "code": "400_bad_request", "meta": {}}], "meta": {}} + RevokeAgentTask: + speakeasy-default-revoke-agent-task: + parameters: + path: + agent_task_id: "" + responses: + "200": + application/json: {"object": "agent_task", "agent_id": "", "task_id": "", "url": "https://peaceful-railway.net"} + "400": + application/json: {"errors": [{"message": "Invalid input", "long_message": "The input provided does not meet the requirements.", "code": "400_bad_request", "meta": {}}], "meta": {}} examplesVersion: 1.0.2 generatedTests: {} +releaseNotes: | + ## Python SDK Changes: + * `clerk.users.get_billing_credit_balance()`: **Added** + * `clerk.users.adjust_billing_credit_balance()`: **Added** + * `clerk.instance_settings.get_o_auth_application_settings()`: **Added** + * `clerk.instance_settings.update_o_auth_application_settings()`: **Added** + * `clerk.organizations.get_billing_credit_balance()`: **Added** + * `clerk.organizations.adjust_billing_credit_balance()`: **Added** + * `clerk.agent_tasks.create()`: **Added** + * `clerk.agent_tasks.revoke()`: **Added** + * `clerk.email_addresses.create()`: `error.status[409]` **Added** + * `clerk.email_addresses.update()`: `error.status[409]` **Added** + * `clerk.users.update()`: `error.status[409]` **Added** + * `clerk.users.get_billing_subscription()`: `response.subscription_items[]` **Changed** + * `clerk.users.get_organization_invitations()`: `request.status` **Changed** + * `clerk.organization_invitations.get_all()`: `request.status` **Changed** + * `clerk.organization_invitations.create()`: `error.status[402]` **Added** + * `clerk.organization_invitations.list()`: `request.status` **Changed** + * `clerk.organizations.update()`: `error.status[400]` **Added** + * `clerk.organizations.get_billing_subscription()`: `response.subscription_items[]` **Changed** + * `clerk.billing.list_plans()`: `response.data[].unit_prices` **Added** + * `clerk.billing.list_prices()`: `response.data[].is_default` **Added** + * `clerk.billing.create_price()`: `response.is_default` **Added** + * `clerk.billing.list_subscription_items()`: `response.data[]` **Changed** + * `clerk.billing.cancel_subscription_item()`: `response` **Changed** + * `clerk.billing.create_price_transition()`: `response.transition.previous_price.is_default` **Added** + * `clerk.billing.list_statements()`: `response.data[]` **Changed** + * `clerk.billing.get_statement()`: `response` **Changed** + * `clerk.billing.get_statement_payment_attempts()`: `response.data[].totals` **Added** + * `clerk.m2m.create_token()`: `request.token_format` **Added** generatedFiles: - .gitattributes - .vscode/settings.json diff --git a/.speakeasy/gen.yaml b/.speakeasy/gen.yaml index 347bda85..bd817936 100644 --- a/.speakeasy/gen.yaml +++ b/.speakeasy/gen.yaml @@ -14,6 +14,7 @@ generation: securityFeb2025: false sharedErrorComponentsApr2025: false sharedNestedComponentsJan2026: false + nameOverrideFeb2026: false auth: oAuth2ClientCredentialsEnabled: true oAuth2PasswordEnabled: false @@ -28,7 +29,7 @@ generation: generateNewTests: false skipResponseBodyAssertions: false python: - version: 5.0.2 + version: 5.0.3 additionalDependencies: dev: pytest: ^8.3.3 diff --git a/.speakeasy/workflow.lock b/.speakeasy/workflow.lock index 97208cda..30ac4cb8 100644 --- a/.speakeasy/workflow.lock +++ b/.speakeasy/workflow.lock @@ -1,21 +1,20 @@ -speakeasyVersion: 1.722.7 +speakeasyVersion: 1.749.0 sources: clerk-openapi: sourceNamespace: clerk-openapi - sourceRevisionDigest: sha256:462d45be7f10aaff916038f04cc6babc7a1e8715b1192b99bdebc6e30f779fe6 - sourceBlobDigest: sha256:28b80146cb86e89b43da259a5635a1f1d166bb391c12ec86a9c88b08a00e69f9 + sourceRevisionDigest: sha256:3d3d4b5ccc50a8d4cde2f5139bc03740c1ff73dc2c267f41f2517cedfc9aa0f1 + sourceBlobDigest: sha256:bff224297eb7444a3d20c964817233b4686dddc55cc1903af5c85942f90bebc6 tags: - latest - - speakeasy-sdk-regen-1771516524 - "2025-11-10" targets: clerk-sdk-python: source: clerk-openapi sourceNamespace: clerk-openapi - sourceRevisionDigest: sha256:462d45be7f10aaff916038f04cc6babc7a1e8715b1192b99bdebc6e30f779fe6 - sourceBlobDigest: sha256:28b80146cb86e89b43da259a5635a1f1d166bb391c12ec86a9c88b08a00e69f9 + sourceRevisionDigest: sha256:3d3d4b5ccc50a8d4cde2f5139bc03740c1ff73dc2c267f41f2517cedfc9aa0f1 + sourceBlobDigest: sha256:bff224297eb7444a3d20c964817233b4686dddc55cc1903af5c85942f90bebc6 codeSamplesNamespace: clerk-openapi-python-code-samples - codeSamplesRevisionDigest: sha256:c5084bc4aa66a00a42a4855047098fdc697422270ef934f6e9d658fa55a9ea9a + codeSamplesRevisionDigest: sha256:f239857754b1b097825d7de9aa75702a39bdb116d18f71290089b264edcd6b3f workflow: workflowVersion: 1.0.0 speakeasyVersion: latest @@ -36,7 +35,7 @@ workflow: output: . publish: pypi: - token: $pypi_token + useTrustedPublishing: true codeSamples: registry: location: registry.speakeasyapi.dev/clerk/clerk/clerk-openapi-python-code-samples diff --git a/README.md b/README.md index 405744e3..63a3b5eb 100644 --- a/README.md +++ b/README.md @@ -255,6 +255,11 @@ def verify_machine_token(request: httpx.Request): * [create](docs/sdks/actortokens/README.md#create) - Create actor token * [revoke](docs/sdks/actortokens/README.md#revoke) - Revoke actor token +### [AgentTasks](docs/sdks/agenttasks/README.md) + +* [create](docs/sdks/agenttasks/README.md#create) - Create agent task +* [revoke](docs/sdks/agenttasks/README.md#revoke) - Revoke agent task + ### [AllowlistIdentifiers](docs/sdks/allowlistidentifiers/README.md) * [list](docs/sdks/allowlistidentifiers/README.md#list) - List all identifiers on the allow-list @@ -332,6 +337,8 @@ def verify_machine_token(request: httpx.Request): * [get](docs/sdks/instancesettingssdk/README.md#get) - Fetch the current instance * [update](docs/sdks/instancesettingssdk/README.md#update) - Update instance settings * [update_restrictions](docs/sdks/instancesettingssdk/README.md#update_restrictions) - Update instance restrictions +* [get_o_auth_application_settings](docs/sdks/instancesettingssdk/README.md#get_o_auth_application_settings) - Get OAuth application settings +* [update_o_auth_application_settings](docs/sdks/instancesettingssdk/README.md#update_o_auth_application_settings) - Update OAuth application settings * [change_domain](docs/sdks/instancesettingssdk/README.md#change_domain) - Update production instance domain * [update_organization_settings](docs/sdks/instancesettingssdk/README.md#update_organization_settings) - Update instance organization settings * [get_instance_protect](docs/sdks/instancesettingssdk/README.md#get_instance_protect) - Get instance protect settings @@ -447,6 +454,8 @@ def verify_machine_token(request: httpx.Request): * [upload_logo](docs/sdks/organizationssdk/README.md#upload_logo) - Upload a logo for the organization * [delete_logo](docs/sdks/organizationssdk/README.md#delete_logo) - Delete the organization's logo. * [get_billing_subscription](docs/sdks/organizationssdk/README.md#get_billing_subscription) - Retrieve an organization's billing subscription +* [get_billing_credit_balance](docs/sdks/organizationssdk/README.md#get_billing_credit_balance) - Retrieve an organization's credit balance +* [adjust_billing_credit_balance](docs/sdks/organizationssdk/README.md#adjust_billing_credit_balance) - Adjust an organization's credit balance ### [PhoneNumbers](docs/sdks/phonenumbers/README.md) @@ -530,6 +539,8 @@ def verify_machine_token(request: httpx.Request): * [delete_profile_image](docs/sdks/users/README.md#delete_profile_image) - Delete user profile image * [update_metadata](docs/sdks/users/README.md#update_metadata) - Merge and update a user's metadata * [get_billing_subscription](docs/sdks/users/README.md#get_billing_subscription) - Retrieve a user's billing subscription +* [get_billing_credit_balance](docs/sdks/users/README.md#get_billing_credit_balance) - Retrieve a user's credit balance +* [adjust_billing_credit_balance](docs/sdks/users/README.md#adjust_billing_credit_balance) - Adjust a user's credit balance * [get_o_auth_access_token](docs/sdks/users/README.md#get_o_auth_access_token) - Retrieve the OAuth access token of a user * [get_organization_memberships](docs/sdks/users/README.md#get_organization_memberships) - Retrieve all memberships for a user * [get_organization_invitations](docs/sdks/users/README.md#get_organization_invitations) - Retrieve all invitations for a user @@ -693,33 +704,33 @@ with Clerk( **Inherit from [`ClerkBaseError`](./src/clerk_backend_api/models/clerkbaseerror.py)**: -* [`CreateAPIKeyAPIKeysResponseBody`](./src/clerk_backend_api/models/createapikeyapikeysresponsebody.py): 400 Bad Request. Status code `400`. Applicable to 1 of 193 methods.* -* [`GetAPIKeysAPIKeysResponseBody`](./src/clerk_backend_api/models/getapikeysapikeysresponsebody.py): 400 Bad Request. Status code `400`. Applicable to 1 of 193 methods.* -* [`GetAPIKeyAPIKeysResponseBody`](./src/clerk_backend_api/models/getapikeyapikeysresponsebody.py): 400 Bad Request. Status code `400`. Applicable to 1 of 193 methods.* -* [`UpdateAPIKeyAPIKeysResponseBody`](./src/clerk_backend_api/models/updateapikeyapikeysresponsebody.py): 400 Bad Request. Status code `400`. Applicable to 1 of 193 methods.* -* [`DeleteAPIKeyAPIKeysResponseBody`](./src/clerk_backend_api/models/deleteapikeyapikeysresponsebody.py): 400 Bad Request. Status code `400`. Applicable to 1 of 193 methods.* -* [`GetAPIKeySecretAPIKeysResponseBody`](./src/clerk_backend_api/models/getapikeysecretapikeysresponsebody.py): 400 Bad Request. Status code `400`. Applicable to 1 of 193 methods.* -* [`RevokeAPIKeyAPIKeysResponseBody`](./src/clerk_backend_api/models/revokeapikeyapikeysresponsebody.py): 400 Bad Request. Status code `400`. Applicable to 1 of 193 methods.* -* [`VerifyAPIKeyAPIKeysResponseBody`](./src/clerk_backend_api/models/verifyapikeyapikeysresponsebody.py): 400 Bad Request. Status code `400`. Applicable to 1 of 193 methods.* -* [`CreateM2MTokenM2mResponseBody`](./src/clerk_backend_api/models/createm2mtokenm2mresponsebody.py): 400 Bad Request. Status code `400`. Applicable to 1 of 193 methods.* -* [`GetM2MTokensM2mResponseBody`](./src/clerk_backend_api/models/getm2mtokensm2mresponsebody.py): 400 Bad Request. Status code `400`. Applicable to 1 of 193 methods.* -* [`RevokeM2MTokenM2mResponseBody`](./src/clerk_backend_api/models/revokem2mtokenm2mresponsebody.py): 400 Bad Request. Status code `400`. Applicable to 1 of 193 methods.* -* [`VerifyM2MTokenM2mResponseBody`](./src/clerk_backend_api/models/verifym2mtokenm2mresponsebody.py): 400 Bad Request. Status code `400`. Applicable to 1 of 193 methods.* -* [`VerifyOAuthAccessTokenOauthAccessTokensResponseBody`](./src/clerk_backend_api/models/verifyoauthaccesstokenoauthaccesstokensresponsebody.py): 400 Bad Request. Status code `400`. Applicable to 1 of 193 methods.* -* [`GetM2MTokensM2mResponseResponseBody`](./src/clerk_backend_api/models/getm2mtokensm2mresponseresponsebody.py): 403 Forbidden. Status code `403`. Applicable to 1 of 193 methods.* -* [`GetAPIKeysAPIKeysResponseResponseBody`](./src/clerk_backend_api/models/getapikeysapikeysresponseresponsebody.py): 404 Not Found. Status code `404`. Applicable to 1 of 193 methods.* -* [`GetAPIKeyAPIKeysResponseResponseBody`](./src/clerk_backend_api/models/getapikeyapikeysresponseresponsebody.py): 404 Not Found. Status code `404`. Applicable to 1 of 193 methods.* -* [`UpdateAPIKeyAPIKeysResponseResponseBody`](./src/clerk_backend_api/models/updateapikeyapikeysresponseresponsebody.py): 404 Not Found. Status code `404`. Applicable to 1 of 193 methods.* -* [`DeleteAPIKeyAPIKeysResponseResponseBody`](./src/clerk_backend_api/models/deleteapikeyapikeysresponseresponsebody.py): 404 Not Found. Status code `404`. Applicable to 1 of 193 methods.* -* [`GetAPIKeySecretAPIKeysResponseResponseBody`](./src/clerk_backend_api/models/getapikeysecretapikeysresponseresponsebody.py): 404 Not Found. Status code `404`. Applicable to 1 of 193 methods.* -* [`RevokeAPIKeyAPIKeysResponseResponseBody`](./src/clerk_backend_api/models/revokeapikeyapikeysresponseresponsebody.py): 404 Not Found. Status code `404`. Applicable to 1 of 193 methods.* -* [`VerifyAPIKeyAPIKeysResponseResponseBody`](./src/clerk_backend_api/models/verifyapikeyapikeysresponseresponsebody.py): 404 Not Found. Status code `404`. Applicable to 1 of 193 methods.* -* [`GetM2MTokensM2mResponse404ResponseBody`](./src/clerk_backend_api/models/getm2mtokensm2mresponse404responsebody.py): 404 Not Found. Status code `404`. Applicable to 1 of 193 methods.* -* [`RevokeM2MTokenM2mResponseResponseBody`](./src/clerk_backend_api/models/revokem2mtokenm2mresponseresponsebody.py): 404 Not Found. Status code `404`. Applicable to 1 of 193 methods.* -* [`VerifyM2MTokenM2mResponseResponseBody`](./src/clerk_backend_api/models/verifym2mtokenm2mresponseresponsebody.py): 404 Not Found. Status code `404`. Applicable to 1 of 193 methods.* -* [`VerifyOAuthAccessTokenOauthAccessTokensResponseResponseBody`](./src/clerk_backend_api/models/verifyoauthaccesstokenoauthaccesstokensresponseresponsebody.py): 404 Not Found. Status code `404`. Applicable to 1 of 193 methods.* -* [`CreateAPIKeyAPIKeysResponseResponseBody`](./src/clerk_backend_api/models/createapikeyapikeysresponseresponsebody.py): 409 Conflict. Status code `409`. Applicable to 1 of 193 methods.* -* [`CreateM2MTokenM2mResponseResponseBody`](./src/clerk_backend_api/models/createm2mtokenm2mresponseresponsebody.py): 409 Conflict. Status code `409`. Applicable to 1 of 193 methods.* +* [`CreateAPIKeyAPIKeysResponseBody`](./src/clerk_backend_api/models/createapikeyapikeysresponsebody.py): 400 Bad Request. Status code `400`. Applicable to 1 of 201 methods.* +* [`GetAPIKeysAPIKeysResponseBody`](./src/clerk_backend_api/models/getapikeysapikeysresponsebody.py): 400 Bad Request. Status code `400`. Applicable to 1 of 201 methods.* +* [`GetAPIKeyAPIKeysResponseBody`](./src/clerk_backend_api/models/getapikeyapikeysresponsebody.py): 400 Bad Request. Status code `400`. Applicable to 1 of 201 methods.* +* [`UpdateAPIKeyAPIKeysResponseBody`](./src/clerk_backend_api/models/updateapikeyapikeysresponsebody.py): 400 Bad Request. Status code `400`. Applicable to 1 of 201 methods.* +* [`DeleteAPIKeyAPIKeysResponseBody`](./src/clerk_backend_api/models/deleteapikeyapikeysresponsebody.py): 400 Bad Request. Status code `400`. Applicable to 1 of 201 methods.* +* [`GetAPIKeySecretAPIKeysResponseBody`](./src/clerk_backend_api/models/getapikeysecretapikeysresponsebody.py): 400 Bad Request. Status code `400`. Applicable to 1 of 201 methods.* +* [`RevokeAPIKeyAPIKeysResponseBody`](./src/clerk_backend_api/models/revokeapikeyapikeysresponsebody.py): 400 Bad Request. Status code `400`. Applicable to 1 of 201 methods.* +* [`VerifyAPIKeyAPIKeysResponseBody`](./src/clerk_backend_api/models/verifyapikeyapikeysresponsebody.py): 400 Bad Request. Status code `400`. Applicable to 1 of 201 methods.* +* [`CreateM2MTokenM2mResponseBody`](./src/clerk_backend_api/models/createm2mtokenm2mresponsebody.py): 400 Bad Request. Status code `400`. Applicable to 1 of 201 methods.* +* [`GetM2MTokensM2mResponseBody`](./src/clerk_backend_api/models/getm2mtokensm2mresponsebody.py): 400 Bad Request. Status code `400`. Applicable to 1 of 201 methods.* +* [`RevokeM2MTokenM2mResponseBody`](./src/clerk_backend_api/models/revokem2mtokenm2mresponsebody.py): 400 Bad Request. Status code `400`. Applicable to 1 of 201 methods.* +* [`VerifyM2MTokenM2mResponseBody`](./src/clerk_backend_api/models/verifym2mtokenm2mresponsebody.py): 400 Bad Request. Status code `400`. Applicable to 1 of 201 methods.* +* [`VerifyOAuthAccessTokenOauthAccessTokensResponseBody`](./src/clerk_backend_api/models/verifyoauthaccesstokenoauthaccesstokensresponsebody.py): 400 Bad Request. Status code `400`. Applicable to 1 of 201 methods.* +* [`GetM2MTokensM2mResponseResponseBody`](./src/clerk_backend_api/models/getm2mtokensm2mresponseresponsebody.py): 403 Forbidden. Status code `403`. Applicable to 1 of 201 methods.* +* [`GetAPIKeysAPIKeysResponseResponseBody`](./src/clerk_backend_api/models/getapikeysapikeysresponseresponsebody.py): 404 Not Found. Status code `404`. Applicable to 1 of 201 methods.* +* [`GetAPIKeyAPIKeysResponseResponseBody`](./src/clerk_backend_api/models/getapikeyapikeysresponseresponsebody.py): 404 Not Found. Status code `404`. Applicable to 1 of 201 methods.* +* [`UpdateAPIKeyAPIKeysResponseResponseBody`](./src/clerk_backend_api/models/updateapikeyapikeysresponseresponsebody.py): 404 Not Found. Status code `404`. Applicable to 1 of 201 methods.* +* [`DeleteAPIKeyAPIKeysResponseResponseBody`](./src/clerk_backend_api/models/deleteapikeyapikeysresponseresponsebody.py): 404 Not Found. Status code `404`. Applicable to 1 of 201 methods.* +* [`GetAPIKeySecretAPIKeysResponseResponseBody`](./src/clerk_backend_api/models/getapikeysecretapikeysresponseresponsebody.py): 404 Not Found. Status code `404`. Applicable to 1 of 201 methods.* +* [`RevokeAPIKeyAPIKeysResponseResponseBody`](./src/clerk_backend_api/models/revokeapikeyapikeysresponseresponsebody.py): 404 Not Found. Status code `404`. Applicable to 1 of 201 methods.* +* [`VerifyAPIKeyAPIKeysResponseResponseBody`](./src/clerk_backend_api/models/verifyapikeyapikeysresponseresponsebody.py): 404 Not Found. Status code `404`. Applicable to 1 of 201 methods.* +* [`GetM2MTokensM2mResponse404ResponseBody`](./src/clerk_backend_api/models/getm2mtokensm2mresponse404responsebody.py): 404 Not Found. Status code `404`. Applicable to 1 of 201 methods.* +* [`RevokeM2MTokenM2mResponseResponseBody`](./src/clerk_backend_api/models/revokem2mtokenm2mresponseresponsebody.py): 404 Not Found. Status code `404`. Applicable to 1 of 201 methods.* +* [`VerifyM2MTokenM2mResponseResponseBody`](./src/clerk_backend_api/models/verifym2mtokenm2mresponseresponsebody.py): 404 Not Found. Status code `404`. Applicable to 1 of 201 methods.* +* [`VerifyOAuthAccessTokenOauthAccessTokensResponseResponseBody`](./src/clerk_backend_api/models/verifyoauthaccesstokenoauthaccesstokensresponseresponsebody.py): 404 Not Found. Status code `404`. Applicable to 1 of 201 methods.* +* [`CreateAPIKeyAPIKeysResponseResponseBody`](./src/clerk_backend_api/models/createapikeyapikeysresponseresponsebody.py): 409 Conflict. Status code `409`. Applicable to 1 of 201 methods.* +* [`CreateM2MTokenM2mResponseResponseBody`](./src/clerk_backend_api/models/createm2mtokenm2mresponseresponsebody.py): 409 Conflict. Status code `409`. Applicable to 1 of 201 methods.* * [`ResponseValidationError`](./src/clerk_backend_api/models/responsevalidationerror.py): Type mismatch between the response data and the expected Pydantic model. Provides access to the Pydantic validation error via the `cause` attribute. diff --git a/RELEASES.md b/RELEASES.md index 41ce3052..72b98324 100644 --- a/RELEASES.md +++ b/RELEASES.md @@ -558,4 +558,14 @@ Based on: ### Generated - [python v5.0.2] . ### Releases -- [PyPI v5.0.2] https://pypi.org/project/clerk-backend-api/5.0.2 - . \ No newline at end of file +- [PyPI v5.0.2] https://pypi.org/project/clerk-backend-api/5.0.2 - . + +## 2026-03-09 00:30:51 +### Changes +Based on: +- OpenAPI Doc +- Speakeasy CLI 1.749.0 (2.855.2) https://github.com/speakeasy-api/speakeasy +### Generated +- [python v5.0.3] . +### Releases +- [PyPI v5.0.3] https://pypi.org/project/clerk-backend-api/5.0.3 - . \ No newline at end of file diff --git a/docs/models/action.md b/docs/models/action.md new file mode 100644 index 00000000..9533c7e4 --- /dev/null +++ b/docs/models/action.md @@ -0,0 +1,19 @@ +# Action + +Whether to increase or decrease the credit balance. + +## Example Usage + +```python +from clerk_backend_api.models import Action + +value = Action.INCREASE +``` + + +## Values + +| Name | Value | +| ---------- | ---------- | +| `INCREASE` | increase | +| `DECREASE` | decrease | \ No newline at end of file diff --git a/docs/models/actortokenobject.md b/docs/models/actortokenobject.md index 354c3afc..2b8e58ba 100644 --- a/docs/models/actortokenobject.md +++ b/docs/models/actortokenobject.md @@ -1,5 +1,13 @@ # ActorTokenObject +## Example Usage + +```python +from clerk_backend_api.models import ActorTokenObject + +value = ActorTokenObject.ACTOR_TOKEN +``` + ## Values diff --git a/docs/models/actortokenstatus.md b/docs/models/actortokenstatus.md index f7dd5772..01c5c2da 100644 --- a/docs/models/actortokenstatus.md +++ b/docs/models/actortokenstatus.md @@ -1,5 +1,13 @@ # ActorTokenStatus +## Example Usage + +```python +from clerk_backend_api.models import ActorTokenStatus + +value = ActorTokenStatus.PENDING +``` + ## Values diff --git a/docs/models/adjustcreditbalancerequest.md b/docs/models/adjustcreditbalancerequest.md new file mode 100644 index 00000000..93b77679 --- /dev/null +++ b/docs/models/adjustcreditbalancerequest.md @@ -0,0 +1,12 @@ +# AdjustCreditBalanceRequest + + +## Fields + +| Field | Type | Required | Description | +| --------------------------------------------------------------------------------------------------------------------------------- | --------------------------------------------------------------------------------------------------------------------------------- | --------------------------------------------------------------------------------------------------------------------------------- | --------------------------------------------------------------------------------------------------------------------------------- | +| `amount` | *int* | :heavy_check_mark: | The credit amount in cents. Must be greater than zero. | +| `action` | [models.Action](../models/action.md) | :heavy_check_mark: | Whether to increase or decrease the credit balance. | +| `currency` | *Optional[str]* | :heavy_minus_sign: | The currency code (e.g. "USD"). Defaults to USD if not provided. | +| `idempotency_key` | *str* | :heavy_check_mark: | A unique key to ensure the adjustment is applied only once. Repeated requests with the same key return the original ledger entry. | +| `note` | *Optional[str]* | :heavy_minus_sign: | An optional note to attach to the ledger entry. | \ No newline at end of file diff --git a/docs/models/adjustorganizationbillingcreditbalancerequest.md b/docs/models/adjustorganizationbillingcreditbalancerequest.md new file mode 100644 index 00000000..35997453 --- /dev/null +++ b/docs/models/adjustorganizationbillingcreditbalancerequest.md @@ -0,0 +1,9 @@ +# AdjustOrganizationBillingCreditBalanceRequest + + +## Fields + +| Field | Type | Required | Description | +| ---------------------------------------------------------------------------- | ---------------------------------------------------------------------------- | ---------------------------------------------------------------------------- | ---------------------------------------------------------------------------- | +| `organization_id` | *str* | :heavy_check_mark: | The ID of the organization whose credit balance to adjust | +| `adjust_credit_balance_request` | [models.AdjustCreditBalanceRequest](../models/adjustcreditbalancerequest.md) | :heavy_check_mark: | Parameters for the credit balance adjustment | \ No newline at end of file diff --git a/docs/models/adjustuserbillingcreditbalancerequest.md b/docs/models/adjustuserbillingcreditbalancerequest.md new file mode 100644 index 00000000..de4790f1 --- /dev/null +++ b/docs/models/adjustuserbillingcreditbalancerequest.md @@ -0,0 +1,9 @@ +# AdjustUserBillingCreditBalanceRequest + + +## Fields + +| Field | Type | Required | Description | +| ---------------------------------------------------------------------------- | ---------------------------------------------------------------------------- | ---------------------------------------------------------------------------- | ---------------------------------------------------------------------------- | +| `user_id` | *str* | :heavy_check_mark: | The ID of the user whose credit balance to adjust | +| `adjust_credit_balance_request` | [models.AdjustCreditBalanceRequest](../models/adjustcreditbalancerequest.md) | :heavy_check_mark: | Parameters for the credit balance adjustment | \ No newline at end of file diff --git a/docs/models/agenttask.md b/docs/models/agenttask.md new file mode 100644 index 00000000..686502d8 --- /dev/null +++ b/docs/models/agenttask.md @@ -0,0 +1,13 @@ +# AgentTask + +Success + + +## Fields + +| Field | Type | Required | Description | +| -------------------------------------------------------------------------------------------------------------- | -------------------------------------------------------------------------------------------------------------- | -------------------------------------------------------------------------------------------------------------- | -------------------------------------------------------------------------------------------------------------- | +| `object` | [models.AgentTaskObject](../models/agenttaskobject.md) | :heavy_check_mark: | N/A | +| `agent_id` | *str* | :heavy_check_mark: | A stable identifier for the agent, unique per agent_name within an instance.
| +| `task_id` | *str* | :heavy_check_mark: | A unique identifier for this agent task.
| +| `url` | *Optional[str]* | :heavy_minus_sign: | The URL that, when visited, creates a session for the user. Only present in the response to a create request.
| \ No newline at end of file diff --git a/docs/models/agenttaskobject.md b/docs/models/agenttaskobject.md new file mode 100644 index 00000000..f3969970 --- /dev/null +++ b/docs/models/agenttaskobject.md @@ -0,0 +1,16 @@ +# AgentTaskObject + +## Example Usage + +```python +from clerk_backend_api.models import AgentTaskObject + +value = AgentTaskObject.AGENT_TASK +``` + + +## Values + +| Name | Value | +| ------------ | ------------ | +| `AGENT_TASK` | agent_task | \ No newline at end of file diff --git a/docs/models/allowlistidentifierobject.md b/docs/models/allowlistidentifierobject.md index 5473a90a..aff706fe 100644 --- a/docs/models/allowlistidentifierobject.md +++ b/docs/models/allowlistidentifierobject.md @@ -3,6 +3,14 @@ String representing the object's type. Objects of the same type share the same value. +## Example Usage + +```python +from clerk_backend_api.models import AllowlistIdentifierObject + +value = AllowlistIdentifierObject.ALLOWLIST_IDENTIFIER +``` + ## Values diff --git a/docs/models/balance.md b/docs/models/balance.md new file mode 100644 index 00000000..47f6b2c2 --- /dev/null +++ b/docs/models/balance.md @@ -0,0 +1,13 @@ +# Balance + +The current credit balance. Null when the payer has never had credits. + + +## Fields + +| Field | Type | Required | Description | +| -------------------------------------------------- | -------------------------------------------------- | -------------------------------------------------- | -------------------------------------------------- | +| `amount` | *int* | :heavy_check_mark: | The amount in cents. | +| `amount_formatted` | *str* | :heavy_check_mark: | The formatted amount as a string (e.g., "$49.99"). | +| `currency` | *str* | :heavy_check_mark: | The currency code (e.g., "USD"). | +| `currency_symbol` | *str* | :heavy_check_mark: | The currency symbol (e.g., "$"). | \ No newline at end of file diff --git a/docs/models/billingpaymentattempt.md b/docs/models/billingpaymentattempt.md index ff67b3c8..a59dd421 100644 --- a/docs/models/billingpaymentattempt.md +++ b/docs/models/billingpaymentattempt.md @@ -3,27 +3,28 @@ ## Fields -| Field | Type | Required | Description | -| ------------------------------------------------------------------------------------- | ------------------------------------------------------------------------------------- | ------------------------------------------------------------------------------------- | ------------------------------------------------------------------------------------- | -| `object` | [models.BillingPaymentAttemptObject](../models/billingpaymentattemptobject.md) | :heavy_check_mark: | String representing the object's type. Objects of the same type share the same value. | -| `id` | *str* | :heavy_check_mark: | Unique identifier for the payment attempt. | -| `payment_id` | *str* | :heavy_check_mark: | Unique identifier for the associated payment. | -| `instance_id` | *str* | :heavy_check_mark: | The ID of the instance this payment attempt belongs to. | -| `charge_type` | *str* | :heavy_check_mark: | Type of charge for this payment attempt. | -| `payee_id` | *str* | :heavy_check_mark: | Unique identifier for the payee. | -| `payee` | [models.Payee](../models/payee.md) | :heavy_check_mark: | The payee associated with this payment attempt. | -| `payer_id` | *str* | :heavy_check_mark: | Unique identifier for the payer. | -| `payer` | [models.CommercePayerResponse](../models/commercepayerresponse.md) | :heavy_check_mark: | N/A | -| `subscription_item_id` | *Optional[str]* | :heavy_minus_sign: | Unique identifier for the associated subscription item. | -| `subscription_item` | [Optional[models.SubscriptionItem]](../models/subscriptionitem.md) | :heavy_minus_sign: | The subscription item associated with this payment attempt. | -| `amount` | [models.CommerceMoneyResponse](../models/commercemoneyresponse.md) | :heavy_check_mark: | N/A | -| `payment_method_id` | *str* | :heavy_check_mark: | Unique identifier for the payment method. | -| `payment_method` | [models.CommercePaymentMethodResponse](../models/commercepaymentmethodresponse.md) | :heavy_check_mark: | N/A | -| `statement_id` | *str* | :heavy_check_mark: | Unique identifier for the associated statement. | -| `gateway_external_id` | *Nullable[str]* | :heavy_check_mark: | External identifier from the payment gateway. | -| `gateway_external_url` | *Nullable[str]* | :heavy_check_mark: | External URL from the payment gateway. | -| `status` | [models.BillingPaymentAttemptStatus](../models/billingpaymentattemptstatus.md) | :heavy_check_mark: | The current status of the payment attempt. | -| `paid_at` | *Nullable[int]* | :heavy_check_mark: | Unix timestamp (in milliseconds) when the payment was completed. | -| `failed_at` | *Nullable[int]* | :heavy_check_mark: | Unix timestamp (in milliseconds) when the payment failed to be processed. | -| `created_at` | *int* | :heavy_check_mark: | Unix timestamp (in milliseconds) when the payment attempt was created. | -| `updated_at` | *int* | :heavy_check_mark: | Unix timestamp (in milliseconds) when the payment attempt was last updated. | \ No newline at end of file +| Field | Type | Required | Description | +| ------------------------------------------------------------------------------------------------ | ------------------------------------------------------------------------------------------------ | ------------------------------------------------------------------------------------------------ | ------------------------------------------------------------------------------------------------ | +| `object` | [models.BillingPaymentAttemptObject](../models/billingpaymentattemptobject.md) | :heavy_check_mark: | String representing the object's type. Objects of the same type share the same value. | +| `id` | *str* | :heavy_check_mark: | Unique identifier for the payment attempt. | +| `payment_id` | *str* | :heavy_check_mark: | Unique identifier for the associated payment. | +| `instance_id` | *str* | :heavy_check_mark: | The ID of the instance this payment attempt belongs to. | +| `charge_type` | *str* | :heavy_check_mark: | Type of charge for this payment attempt. | +| `payee_id` | *str* | :heavy_check_mark: | Unique identifier for the payee. | +| `payee` | [models.Payee](../models/payee.md) | :heavy_check_mark: | The payee associated with this payment attempt. | +| `payer_id` | *str* | :heavy_check_mark: | Unique identifier for the payer. | +| `payer` | [models.CommercePayerResponse](../models/commercepayerresponse.md) | :heavy_check_mark: | N/A | +| `subscription_item_id` | *Optional[str]* | :heavy_minus_sign: | Unique identifier for the associated subscription item. | +| `subscription_item` | [Optional[models.SubscriptionItem]](../models/subscriptionitem.md) | :heavy_minus_sign: | The subscription item associated with this payment attempt. | +| `amount` | [models.CommerceMoneyResponse](../models/commercemoneyresponse.md) | :heavy_check_mark: | N/A | +| `totals` | [OptionalNullable[models.BillingPaymentAttemptTotals]](../models/billingpaymentattempttotals.md) | :heavy_minus_sign: | Totals breakdown for this payment attempt. | +| `payment_method_id` | *str* | :heavy_check_mark: | Unique identifier for the payment method. | +| `payment_method` | [models.CommercePaymentMethodResponse](../models/commercepaymentmethodresponse.md) | :heavy_check_mark: | N/A | +| `statement_id` | *str* | :heavy_check_mark: | Unique identifier for the associated statement. | +| `gateway_external_id` | *Nullable[str]* | :heavy_check_mark: | External identifier from the payment gateway. | +| `gateway_external_url` | *Nullable[str]* | :heavy_check_mark: | External URL from the payment gateway. | +| `status` | [models.BillingPaymentAttemptStatus](../models/billingpaymentattemptstatus.md) | :heavy_check_mark: | The current status of the payment attempt. | +| `paid_at` | *Nullable[int]* | :heavy_check_mark: | Unix timestamp (in milliseconds) when the payment was completed. | +| `failed_at` | *Nullable[int]* | :heavy_check_mark: | Unix timestamp (in milliseconds) when the payment failed to be processed. | +| `created_at` | *int* | :heavy_check_mark: | Unix timestamp (in milliseconds) when the payment attempt was created. | +| `updated_at` | *int* | :heavy_check_mark: | Unix timestamp (in milliseconds) when the payment attempt was last updated. | \ No newline at end of file diff --git a/docs/models/billingpaymentattemptcredits.md b/docs/models/billingpaymentattemptcredits.md new file mode 100644 index 00000000..231c8696 --- /dev/null +++ b/docs/models/billingpaymentattemptcredits.md @@ -0,0 +1,10 @@ +# BillingPaymentAttemptCredits + + +## Fields + +| Field | Type | Required | Description | +| ---------------------------------------------------------------------------------------------- | ---------------------------------------------------------------------------------------------- | ---------------------------------------------------------------------------------------------- | ---------------------------------------------------------------------------------------------- | +| `proration` | [Nullable[models.BillingPaymentAttemptProration]](../models/billingpaymentattemptproration.md) | :heavy_check_mark: | N/A | +| `payer` | [Nullable[models.BillingPaymentAttemptPayer]](../models/billingpaymentattemptpayer.md) | :heavy_check_mark: | N/A | +| `total` | [models.CommerceMoneyResponse](../models/commercemoneyresponse.md) | :heavy_check_mark: | N/A | \ No newline at end of file diff --git a/docs/models/billingpaymentattemptobject.md b/docs/models/billingpaymentattemptobject.md index 878a0252..d7b52737 100644 --- a/docs/models/billingpaymentattemptobject.md +++ b/docs/models/billingpaymentattemptobject.md @@ -2,6 +2,14 @@ String representing the object's type. Objects of the same type share the same value. +## Example Usage + +```python +from clerk_backend_api.models import BillingPaymentAttemptObject + +value = BillingPaymentAttemptObject.COMMERCE_PAYMENT +``` + ## Values diff --git a/docs/models/billingpaymentattemptpayer.md b/docs/models/billingpaymentattemptpayer.md new file mode 100644 index 00000000..84e64a6d --- /dev/null +++ b/docs/models/billingpaymentattemptpayer.md @@ -0,0 +1,9 @@ +# BillingPaymentAttemptPayer + + +## Fields + +| Field | Type | Required | Description | +| ------------------------------------------------------------------ | ------------------------------------------------------------------ | ------------------------------------------------------------------ | ------------------------------------------------------------------ | +| `remaining_balance` | [models.CommerceMoneyResponse](../models/commercemoneyresponse.md) | :heavy_check_mark: | N/A | +| `applied_amount` | [models.CommerceMoneyResponse](../models/commercemoneyresponse.md) | :heavy_check_mark: | N/A | \ No newline at end of file diff --git a/docs/models/billingpaymentattemptproration.md b/docs/models/billingpaymentattemptproration.md new file mode 100644 index 00000000..b83e2b07 --- /dev/null +++ b/docs/models/billingpaymentattemptproration.md @@ -0,0 +1,11 @@ +# BillingPaymentAttemptProration + + +## Fields + +| Field | Type | Required | Description | +| ------------------------------------------------------------------ | ------------------------------------------------------------------ | ------------------------------------------------------------------ | ------------------------------------------------------------------ | +| `amount` | [models.CommerceMoneyResponse](../models/commercemoneyresponse.md) | :heavy_check_mark: | N/A | +| `cycle_days_remaining` | *int* | :heavy_check_mark: | N/A | +| `cycle_days_total` | *int* | :heavy_check_mark: | N/A | +| `cycle_remaining_percent` | *float* | :heavy_check_mark: | N/A | \ No newline at end of file diff --git a/docs/models/billingpaymentattemptstatus.md b/docs/models/billingpaymentattemptstatus.md index 2f1aee48..65d23f4e 100644 --- a/docs/models/billingpaymentattemptstatus.md +++ b/docs/models/billingpaymentattemptstatus.md @@ -2,6 +2,14 @@ The current status of the payment attempt. +## Example Usage + +```python +from clerk_backend_api.models import BillingPaymentAttemptStatus + +value = BillingPaymentAttemptStatus.PENDING +``` + ## Values diff --git a/docs/models/billingpaymentattempttotals.md b/docs/models/billingpaymentattempttotals.md new file mode 100644 index 00000000..04e35934 --- /dev/null +++ b/docs/models/billingpaymentattempttotals.md @@ -0,0 +1,15 @@ +# BillingPaymentAttemptTotals + +Totals breakdown for this payment attempt. + + +## Fields + +| Field | Type | Required | Description | +| -------------------------------------------------------------------------------------------------- | -------------------------------------------------------------------------------------------------- | -------------------------------------------------------------------------------------------------- | -------------------------------------------------------------------------------------------------- | +| `subtotal` | [models.CommerceMoneyResponse](../models/commercemoneyresponse.md) | :heavy_check_mark: | N/A | +| `base_fee` | [models.CommerceMoneyResponse](../models/commercemoneyresponse.md) | :heavy_check_mark: | N/A | +| `tax_total` | [models.CommerceMoneyResponse](../models/commercemoneyresponse.md) | :heavy_check_mark: | N/A | +| `grand_total` | [models.CommerceMoneyResponse](../models/commercemoneyresponse.md) | :heavy_check_mark: | N/A | +| `per_unit_totals` | List[[models.CommercePerUnitTotal](../models/commerceperunittotal.md)] | :heavy_minus_sign: | N/A | +| `credits` | [OptionalNullable[models.BillingPaymentAttemptCredits]](../models/billingpaymentattemptcredits.md) | :heavy_minus_sign: | N/A | \ No newline at end of file diff --git a/docs/models/billingpriceresponse.md b/docs/models/billingpriceresponse.md index f414141a..03d82b3c 100644 --- a/docs/models/billingpriceresponse.md +++ b/docs/models/billingpriceresponse.md @@ -16,4 +16,5 @@ | `fee` | [models.CommerceMoneyResponse](../models/commercemoneyresponse.md) | :heavy_check_mark: | N/A | | `annual_monthly_fee` | [models.CommerceMoneyResponse](../models/commercemoneyresponse.md) | :heavy_check_mark: | N/A | | `description` | *OptionalNullable[str]* | :heavy_minus_sign: | The description of the price. | +| `is_default` | *bool* | :heavy_check_mark: | Whether this price is the default price for its plan. | | `created_at` | *int* | :heavy_check_mark: | Unix timestamp (milliseconds) of creation. | \ No newline at end of file diff --git a/docs/models/billingpriceresponseobject.md b/docs/models/billingpriceresponseobject.md index d19b4d87..c9b52faf 100644 --- a/docs/models/billingpriceresponseobject.md +++ b/docs/models/billingpriceresponseobject.md @@ -2,6 +2,14 @@ String representing the object's type. Objects of the same type share the same value. +## Example Usage + +```python +from clerk_backend_api.models import BillingPriceResponseObject + +value = BillingPriceResponseObject.COMMERCE_PRICE +``` + ## Values diff --git a/docs/models/billingstatement.md b/docs/models/billingstatement.md index 32608869..3827784b 100644 --- a/docs/models/billingstatement.md +++ b/docs/models/billingstatement.md @@ -11,5 +11,5 @@ | `timestamp` | *int* | :heavy_check_mark: | Unix timestamp (in milliseconds) when the statement was created. | | `payer` | [models.CommercePayerResponse](../models/commercepayerresponse.md) | :heavy_check_mark: | N/A | | `status` | [models.BillingStatementStatus](../models/billingstatementstatus.md) | :heavy_check_mark: | The current status of the statement. | -| `totals` | [models.Totals](../models/totals.md) | :heavy_check_mark: | Totals for the statement. | +| `totals` | [models.BillingStatementTotals](../models/billingstatementtotals.md) | :heavy_check_mark: | Totals for the statement. | | `groups` | List[[models.Groups](../models/groups.md)] | :heavy_check_mark: | Array of statement groups. | \ No newline at end of file diff --git a/docs/models/billingstatementgroupsobject.md b/docs/models/billingstatementgroupsobject.md index 064ebf0d..b0d03182 100644 --- a/docs/models/billingstatementgroupsobject.md +++ b/docs/models/billingstatementgroupsobject.md @@ -2,6 +2,14 @@ String representing the object's type. Objects of the same type share the same value. +## Example Usage + +```python +from clerk_backend_api.models import BillingStatementGroupsObject + +value = BillingStatementGroupsObject.COMMERCE_STATEMENT_GROUP +``` + ## Values diff --git a/docs/models/billingstatementobject.md b/docs/models/billingstatementobject.md index f7f30f33..f4341401 100644 --- a/docs/models/billingstatementobject.md +++ b/docs/models/billingstatementobject.md @@ -2,6 +2,14 @@ String representing the object's type. Objects of the same type share the same value. +## Example Usage + +```python +from clerk_backend_api.models import BillingStatementObject + +value = BillingStatementObject.COMMERCE_STATEMENT +``` + ## Values diff --git a/docs/models/billingstatementstatus.md b/docs/models/billingstatementstatus.md index fd265e14..3cfa0ddf 100644 --- a/docs/models/billingstatementstatus.md +++ b/docs/models/billingstatementstatus.md @@ -2,6 +2,14 @@ The current status of the statement. +## Example Usage + +```python +from clerk_backend_api.models import BillingStatementStatus + +value = BillingStatementStatus.OPEN +``` + ## Values diff --git a/docs/models/billingstatementtotals.md b/docs/models/billingstatementtotals.md new file mode 100644 index 00000000..4e5ef193 --- /dev/null +++ b/docs/models/billingstatementtotals.md @@ -0,0 +1,13 @@ +# BillingStatementTotals + +Totals for the statement. + + +## Fields + +| Field | Type | Required | Description | +| ------------------------------------------------------------------ | ------------------------------------------------------------------ | ------------------------------------------------------------------ | ------------------------------------------------------------------ | +| `grand_total` | [models.CommerceMoneyResponse](../models/commercemoneyresponse.md) | :heavy_check_mark: | N/A | +| `subtotal` | [models.CommerceMoneyResponse](../models/commercemoneyresponse.md) | :heavy_check_mark: | N/A | +| `base_fee` | [models.CommerceMoneyResponse](../models/commercemoneyresponse.md) | :heavy_check_mark: | N/A | +| `tax_total` | [models.CommerceMoneyResponse](../models/commercemoneyresponse.md) | :heavy_check_mark: | N/A | \ No newline at end of file diff --git a/docs/models/blocklistidentifieridentifiertype.md b/docs/models/blocklistidentifieridentifiertype.md index 21f7db06..0709a80b 100644 --- a/docs/models/blocklistidentifieridentifiertype.md +++ b/docs/models/blocklistidentifieridentifiertype.md @@ -1,5 +1,13 @@ # BlocklistIdentifierIdentifierType +## Example Usage + +```python +from clerk_backend_api.models import BlocklistIdentifierIdentifierType + +value = BlocklistIdentifierIdentifierType.EMAIL_ADDRESS +``` + ## Values diff --git a/docs/models/blocklistidentifierobject.md b/docs/models/blocklistidentifierobject.md index 9efb8aff..e33f9f8f 100644 --- a/docs/models/blocklistidentifierobject.md +++ b/docs/models/blocklistidentifierobject.md @@ -3,6 +3,14 @@ String representing the object's type. Objects of the same type share the same value. +## Example Usage + +```python +from clerk_backend_api.models import BlocklistIdentifierObject + +value = BlocklistIdentifierObject.BLOCKLIST_IDENTIFIER +``` + ## Values diff --git a/docs/models/codetype.md b/docs/models/codetype.md index e3d81cea..d394be1c 100644 --- a/docs/models/codetype.md +++ b/docs/models/codetype.md @@ -1,5 +1,13 @@ # CodeType +## Example Usage + +```python +from clerk_backend_api.models import CodeType + +value = CodeType.TOTP +``` + ## Values diff --git a/docs/models/commercecreditbalanceresponse.md b/docs/models/commercecreditbalanceresponse.md new file mode 100644 index 00000000..ce6bac51 --- /dev/null +++ b/docs/models/commercecreditbalanceresponse.md @@ -0,0 +1,11 @@ +# CommerceCreditBalanceResponse + +A payer's credit balance. + + +## Fields + +| Field | Type | Required | Description | +| ------------------------------------------------------------------------ | ------------------------------------------------------------------------ | ------------------------------------------------------------------------ | ------------------------------------------------------------------------ | +| `object` | *str* | :heavy_check_mark: | String representing the object's type. Always "commerce_credit_balance". | +| `balance` | [Nullable[models.Balance]](../models/balance.md) | :heavy_check_mark: | The current credit balance. Null when the payer has never had credits. | \ No newline at end of file diff --git a/docs/models/commercecreditledgerresponse.md b/docs/models/commercecreditledgerresponse.md new file mode 100644 index 00000000..a3105d23 --- /dev/null +++ b/docs/models/commercecreditledgerresponse.md @@ -0,0 +1,18 @@ +# CommerceCreditLedgerResponse + +A credit ledger entry. + + +## Fields + +| Field | Type | Required | Description | +| ------------------------------------------------------------------------- | ------------------------------------------------------------------------- | ------------------------------------------------------------------------- | ------------------------------------------------------------------------- | +| `object` | *str* | :heavy_check_mark: | String representing the object's type. Always "commerce_credit_ledger". | +| `id` | *str* | :heavy_check_mark: | Unique identifier for the ledger entry. | +| `payer_id` | *str* | :heavy_check_mark: | The ID of the payer whose balance was adjusted. | +| `amount` | *int* | :heavy_check_mark: | The signed credit amount. Positive for increases, negative for decreases. | +| `currency` | *str* | :heavy_check_mark: | The currency code of the credit adjustment. | +| `source_type` | *str* | :heavy_check_mark: | The type of source that originated the adjustment (e.g. "grant"). | +| `source_id` | *str* | :heavy_check_mark: | The ID of the source that originated the adjustment. | +| `note` | *OptionalNullable[str]* | :heavy_minus_sign: | An optional note attached to the ledger entry. | +| `created_at` | [date](https://docs.python.org/3/library/datetime.html#date-objects) | :heavy_check_mark: | Timestamp when the ledger entry was created. | \ No newline at end of file diff --git a/docs/models/commercepayerresponseobject.md b/docs/models/commercepayerresponseobject.md index 248edd78..f96b8ccc 100644 --- a/docs/models/commercepayerresponseobject.md +++ b/docs/models/commercepayerresponseobject.md @@ -2,6 +2,14 @@ String representing the object's type. Objects of the same type share the same value. +## Example Usage + +```python +from clerk_backend_api.models import CommercePayerResponseObject + +value = CommercePayerResponseObject.COMMERCE_PAYER +``` + ## Values diff --git a/docs/models/commercepaymentmethodresponseobject.md b/docs/models/commercepaymentmethodresponseobject.md index 9ba6b3b7..642e9273 100644 --- a/docs/models/commercepaymentmethodresponseobject.md +++ b/docs/models/commercepaymentmethodresponseobject.md @@ -2,6 +2,14 @@ String representing the object's type. Objects of the same type share the same value. +## Example Usage + +```python +from clerk_backend_api.models import CommercePaymentMethodResponseObject + +value = CommercePaymentMethodResponseObject.COMMERCE_PAYMENT_METHOD +``` + ## Values diff --git a/docs/models/commercepaymentmethodresponsestatus.md b/docs/models/commercepaymentmethodresponsestatus.md index 578c6aaa..5b8a2c95 100644 --- a/docs/models/commercepaymentmethodresponsestatus.md +++ b/docs/models/commercepaymentmethodresponsestatus.md @@ -2,6 +2,14 @@ Status of the payment method. +## Example Usage + +```python +from clerk_backend_api.models import CommercePaymentMethodResponseStatus + +value = CommercePaymentMethodResponseStatus.ACTIVE +``` + ## Values diff --git a/docs/models/commerceperunittotal.md b/docs/models/commerceperunittotal.md new file mode 100644 index 00000000..8b90180c --- /dev/null +++ b/docs/models/commerceperunittotal.md @@ -0,0 +1,10 @@ +# CommercePerUnitTotal + + +## Fields + +| Field | Type | Required | Description | +| ------------------------------------------------------------------------------ | ------------------------------------------------------------------------------ | ------------------------------------------------------------------------------ | ------------------------------------------------------------------------------ | +| `name` | *str* | :heavy_check_mark: | Name of the billable unit (for example, seats) | +| `block_size` | *int* | :heavy_check_mark: | Number of units included in each pricing block | +| `tiers` | List[[models.CommercePerUnitTotalTier](../models/commerceperunittotaltier.md)] | :heavy_check_mark: | Computed totals for each pricing tier | \ No newline at end of file diff --git a/docs/models/commerceperunittotaltier.md b/docs/models/commerceperunittotaltier.md new file mode 100644 index 00000000..65998837 --- /dev/null +++ b/docs/models/commerceperunittotaltier.md @@ -0,0 +1,10 @@ +# CommercePerUnitTotalTier + + +## Fields + +| Field | Type | Required | Description | +| ------------------------------------------------------------------ | ------------------------------------------------------------------ | ------------------------------------------------------------------ | ------------------------------------------------------------------ | +| `quantity` | *OptionalNullable[int]* | :heavy_minus_sign: | Units billed in this tier; null means unlimited | +| `fee_per_block` | [models.CommerceMoneyResponse](../models/commercemoneyresponse.md) | :heavy_check_mark: | N/A | +| `total` | [models.CommerceMoneyResponse](../models/commercemoneyresponse.md) | :heavy_check_mark: | N/A | \ No newline at end of file diff --git a/docs/models/commerceplan.md b/docs/models/commerceplan.md index b06af6d1..bc5f02a0 100644 --- a/docs/models/commerceplan.md +++ b/docs/models/commerceplan.md @@ -22,4 +22,5 @@ | `avatar_url` | *Nullable[str]* | :heavy_check_mark: | The URL of the plan's avatar image. | | `features` | List[[models.FeatureResponse](../models/featureresponse.md)] | :heavy_minus_sign: | The features included in this plan. | | `free_trial_enabled` | *bool* | :heavy_check_mark: | Whether free trial is enabled for this plan. | -| `free_trial_days` | *Nullable[int]* | :heavy_check_mark: | Number of free trial days for this plan. | \ No newline at end of file +| `free_trial_days` | *Nullable[int]* | :heavy_check_mark: | Number of free trial days for this plan. | +| `unit_prices` | List[[models.CommercePlanUnitPrice](../models/commerceplanunitprice.md)] | :heavy_minus_sign: | Per-unit pricing tiers for this plan (for example, seats) | \ No newline at end of file diff --git a/docs/models/commerceplanobject.md b/docs/models/commerceplanobject.md index 5fd27e3c..abf478d5 100644 --- a/docs/models/commerceplanobject.md +++ b/docs/models/commerceplanobject.md @@ -2,6 +2,14 @@ String representing the object's type. Objects of the same type share the same value. +## Example Usage + +```python +from clerk_backend_api.models import CommercePlanObject + +value = CommercePlanObject.COMMERCE_PLAN +``` + ## Values diff --git a/docs/models/commerceplanunitprice.md b/docs/models/commerceplanunitprice.md new file mode 100644 index 00000000..487ceb10 --- /dev/null +++ b/docs/models/commerceplanunitprice.md @@ -0,0 +1,10 @@ +# CommercePlanUnitPrice + + +## Fields + +| Field | Type | Required | Description | +| -------------------------------------------------------------------------------- | -------------------------------------------------------------------------------- | -------------------------------------------------------------------------------- | -------------------------------------------------------------------------------- | +| `name` | *str* | :heavy_check_mark: | Name of the billable unit (for example, seats) | +| `block_size` | *int* | :heavy_check_mark: | Number of units included in each pricing block | +| `tiers` | List[[models.CommercePlanUnitPriceTier](../models/commerceplanunitpricetier.md)] | :heavy_check_mark: | Tiered pricing configuration for this unit | \ No newline at end of file diff --git a/docs/models/commerceplanunitpricetier.md b/docs/models/commerceplanunitpricetier.md new file mode 100644 index 00000000..1863c805 --- /dev/null +++ b/docs/models/commerceplanunitpricetier.md @@ -0,0 +1,10 @@ +# CommercePlanUnitPriceTier + + +## Fields + +| Field | Type | Required | Description | +| ------------------------------------------------------------------ | ------------------------------------------------------------------ | ------------------------------------------------------------------ | ------------------------------------------------------------------ | +| `starts_at_block` | *int* | :heavy_check_mark: | Start block (inclusive) for this tier | +| `ends_after_block` | *OptionalNullable[int]* | :heavy_minus_sign: | End block (inclusive) for this tier; null means unlimited | +| `fee_per_block` | [models.CommerceMoneyResponse](../models/commercemoneyresponse.md) | :heavy_check_mark: | N/A | \ No newline at end of file diff --git a/docs/models/commercepricetransitionresponseobject.md b/docs/models/commercepricetransitionresponseobject.md index bcf5af7b..f14e5ab6 100644 --- a/docs/models/commercepricetransitionresponseobject.md +++ b/docs/models/commercepricetransitionresponseobject.md @@ -2,6 +2,14 @@ String representing the object's type. Objects of the same type share the same value. +## Example Usage + +```python +from clerk_backend_api.models import CommercePriceTransitionResponseObject + +value = CommercePriceTransitionResponseObject.COMMERCE_PRICE_TRANSITION +``` + ## Values diff --git a/docs/models/commercesubscriptionitem.md b/docs/models/commercesubscriptionitem.md index da17de96..d5a9f4bf 100644 --- a/docs/models/commercesubscriptionitem.md +++ b/docs/models/commercesubscriptionitem.md @@ -10,6 +10,7 @@ | `instance_id` | *str* | :heavy_check_mark: | Unique identifier for the Clerk instance. | | `status` | [models.CommerceSubscriptionItemStatus](../models/commercesubscriptionitemstatus.md) | :heavy_check_mark: | Current status of the subscription item. | | `credit` | [Optional[models.CommerceSubscriptionCreditResponse]](../models/commercesubscriptioncreditresponse.md) | :heavy_minus_sign: | N/A | +| `credits` | [OptionalNullable[models.Credits]](../models/credits.md) | :heavy_minus_sign: | Unified credits breakdown for this subscription item. | | `plan_id` | *Nullable[str]* | :heavy_check_mark: | Unique identifier for the associated plan. | | `price_id` | *Optional[str]* | :heavy_minus_sign: | Unique identifier for the associated price | | `plan` | [OptionalNullable[models.Plan]](../models/plan.md) | :heavy_minus_sign: | The associated plan. | @@ -27,4 +28,6 @@ | `past_due_at` | *Nullable[int]* | :heavy_check_mark: | Unix timestamp (in milliseconds) when the subscription item became past due. | | `ended_at` | *Nullable[int]* | :heavy_check_mark: | Unix timestamp (in milliseconds) when the subscription item ended. | | `created_at` | *Optional[int]* | :heavy_minus_sign: | Unix timestamp (in milliseconds) when the subscription item was created. | -| `updated_at` | *Optional[int]* | :heavy_minus_sign: | Unix timestamp (in milliseconds) when the subscription item was last updated. | \ No newline at end of file +| `updated_at` | *Optional[int]* | :heavy_minus_sign: | Unix timestamp (in milliseconds) when the subscription item was last updated. | +| `seats` | [OptionalNullable[models.Seats]](../models/seats.md) | :heavy_minus_sign: | Seat quantity for seat-based billing. | +| `totals` | [OptionalNullable[models.Totals]](../models/totals.md) | :heavy_minus_sign: | Totals for this subscription item. | \ No newline at end of file diff --git a/docs/models/commercesubscriptionitemcredits.md b/docs/models/commercesubscriptionitemcredits.md new file mode 100644 index 00000000..e0c9f112 --- /dev/null +++ b/docs/models/commercesubscriptionitemcredits.md @@ -0,0 +1,10 @@ +# CommerceSubscriptionItemCredits + + +## Fields + +| Field | Type | Required | Description | +| -------------------------------------------------------------------------------------------------------- | -------------------------------------------------------------------------------------------------------- | -------------------------------------------------------------------------------------------------------- | -------------------------------------------------------------------------------------------------------- | +| `proration` | [Nullable[models.CommerceSubscriptionItemProration]](../models/commercesubscriptionitemproration.md) | :heavy_check_mark: | N/A | +| `payer` | [Nullable[models.CommerceSubscriptionItemTotalsPayer]](../models/commercesubscriptionitemtotalspayer.md) | :heavy_check_mark: | N/A | +| `total` | [models.CommerceMoneyResponse](../models/commercemoneyresponse.md) | :heavy_check_mark: | N/A | \ No newline at end of file diff --git a/docs/models/commercesubscriptionitemobject.md b/docs/models/commercesubscriptionitemobject.md index 25773afb..d0f618be 100644 --- a/docs/models/commercesubscriptionitemobject.md +++ b/docs/models/commercesubscriptionitemobject.md @@ -2,6 +2,14 @@ String representing the object's type. Objects of the same type share the same value. +## Example Usage + +```python +from clerk_backend_api.models import CommerceSubscriptionItemObject + +value = CommerceSubscriptionItemObject.COMMERCE_SUBSCRIPTION_ITEM +``` + ## Values diff --git a/docs/models/commercesubscriptionitempayer.md b/docs/models/commercesubscriptionitempayer.md new file mode 100644 index 00000000..9e3c4d23 --- /dev/null +++ b/docs/models/commercesubscriptionitempayer.md @@ -0,0 +1,9 @@ +# CommerceSubscriptionItemPayer + + +## Fields + +| Field | Type | Required | Description | +| ------------------------------------------------------------------ | ------------------------------------------------------------------ | ------------------------------------------------------------------ | ------------------------------------------------------------------ | +| `remaining_balance` | [models.CommerceMoneyResponse](../models/commercemoneyresponse.md) | :heavy_check_mark: | N/A | +| `applied_amount` | [models.CommerceMoneyResponse](../models/commercemoneyresponse.md) | :heavy_check_mark: | N/A | \ No newline at end of file diff --git a/docs/models/commercesubscriptionitemplanobject.md b/docs/models/commercesubscriptionitemplanobject.md index 1a050d3f..9fe1fe94 100644 --- a/docs/models/commercesubscriptionitemplanobject.md +++ b/docs/models/commercesubscriptionitemplanobject.md @@ -2,6 +2,14 @@ String representing the object's type. Objects of the same type share the same value. +## Example Usage + +```python +from clerk_backend_api.models import CommerceSubscriptionItemPlanObject + +value = CommerceSubscriptionItemPlanObject.COMMERCE_PLAN +``` + ## Values diff --git a/docs/models/commercesubscriptionitemproration.md b/docs/models/commercesubscriptionitemproration.md new file mode 100644 index 00000000..614dd62c --- /dev/null +++ b/docs/models/commercesubscriptionitemproration.md @@ -0,0 +1,11 @@ +# CommerceSubscriptionItemProration + + +## Fields + +| Field | Type | Required | Description | +| ------------------------------------------------------------------ | ------------------------------------------------------------------ | ------------------------------------------------------------------ | ------------------------------------------------------------------ | +| `amount` | [models.CommerceMoneyResponse](../models/commercemoneyresponse.md) | :heavy_check_mark: | N/A | +| `cycle_days_remaining` | *int* | :heavy_check_mark: | N/A | +| `cycle_days_total` | *int* | :heavy_check_mark: | N/A | +| `cycle_remaining_percent` | *float* | :heavy_check_mark: | N/A | \ No newline at end of file diff --git a/docs/models/commercesubscriptionitemstatus.md b/docs/models/commercesubscriptionitemstatus.md index 89b8ee81..1723fa0e 100644 --- a/docs/models/commercesubscriptionitemstatus.md +++ b/docs/models/commercesubscriptionitemstatus.md @@ -2,6 +2,14 @@ Current status of the subscription item. +## Example Usage + +```python +from clerk_backend_api.models import CommerceSubscriptionItemStatus + +value = CommerceSubscriptionItemStatus.ACTIVE +``` + ## Values diff --git a/docs/models/commercesubscriptionitemtotalspayer.md b/docs/models/commercesubscriptionitemtotalspayer.md new file mode 100644 index 00000000..aeadac9c --- /dev/null +++ b/docs/models/commercesubscriptionitemtotalspayer.md @@ -0,0 +1,9 @@ +# CommerceSubscriptionItemTotalsPayer + + +## Fields + +| Field | Type | Required | Description | +| ------------------------------------------------------------------ | ------------------------------------------------------------------ | ------------------------------------------------------------------ | ------------------------------------------------------------------ | +| `remaining_balance` | [models.CommerceMoneyResponse](../models/commercemoneyresponse.md) | :heavy_check_mark: | N/A | +| `applied_amount` | [models.CommerceMoneyResponse](../models/commercemoneyresponse.md) | :heavy_check_mark: | N/A | \ No newline at end of file diff --git a/docs/models/commercesubscriptionobject.md b/docs/models/commercesubscriptionobject.md index 3bf28a60..2c7b7113 100644 --- a/docs/models/commercesubscriptionobject.md +++ b/docs/models/commercesubscriptionobject.md @@ -2,6 +2,14 @@ String representing the object's type. Objects of the same type share the same value. +## Example Usage + +```python +from clerk_backend_api.models import CommerceSubscriptionObject + +value = CommerceSubscriptionObject.COMMERCE_SUBSCRIPTION +``` + ## Values diff --git a/docs/models/commercesubscriptionstatus.md b/docs/models/commercesubscriptionstatus.md index 252abe0b..9fb3356e 100644 --- a/docs/models/commercesubscriptionstatus.md +++ b/docs/models/commercesubscriptionstatus.md @@ -2,6 +2,14 @@ The current status of the subscription. +## Example Usage + +```python +from clerk_backend_api.models import CommerceSubscriptionStatus + +value = CommerceSubscriptionStatus.ACTIVE +``` + ## Values diff --git a/docs/models/cookiesobject.md b/docs/models/cookiesobject.md index df0347f1..f48c7008 100644 --- a/docs/models/cookiesobject.md +++ b/docs/models/cookiesobject.md @@ -2,6 +2,14 @@ String representing the object's type. Objects of the same type share the same value. +## Example Usage + +```python +from clerk_backend_api.models import CookiesObject + +value = CookiesObject.COOKIES +``` + ## Values diff --git a/docs/models/createagenttaskpermissions.md b/docs/models/createagenttaskpermissions.md new file mode 100644 index 00000000..dcbf8575 --- /dev/null +++ b/docs/models/createagenttaskpermissions.md @@ -0,0 +1,18 @@ +# CreateAgentTaskPermissions + +The permissions granted to the agent task. Must be "*" (all permissions). + +## Example Usage + +```python +from clerk_backend_api.models import CreateAgentTaskPermissions + +value = CreateAgentTaskPermissions.WILDCARD_ +``` + + +## Values + +| Name | Value | +| ----------- | ----------- | +| `WILDCARD_` | * | \ No newline at end of file diff --git a/docs/models/createagenttaskrequestbody.md b/docs/models/createagenttaskrequestbody.md new file mode 100644 index 00000000..191622ff --- /dev/null +++ b/docs/models/createagenttaskrequestbody.md @@ -0,0 +1,13 @@ +# CreateAgentTaskRequestBody + + +## Fields + +| Field | Type | Required | Description | +| ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- | ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- | ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- | ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- | +| `on_behalf_of` | [models.OnBehalfOf](../models/onbehalfof.md) | :heavy_check_mark: | Identifies the user on whose behalf the agent task is created.
Exactly one of user_id or identifier must be provided. | +| `permissions` | [models.CreateAgentTaskPermissions](../models/createagenttaskpermissions.md) | :heavy_check_mark: | The permissions granted to the agent task. Must be "*" (all permissions). | +| `agent_name` | *str* | :heavy_check_mark: | A name identifying the agent. Used to derive a stable agent_id per instance.
Logged for audit purposes. | +| `task_description` | *str* | :heavy_check_mark: | A description of the task being performed. Logged for audit purposes. | +| `redirect_url` | *str* | :heavy_check_mark: | The URL the user is redirected to after the agent task is accepted.
Must be a valid absolute URL with an `https` scheme in production instances.
In development instances, `http` is also permitted.
The URL's domain must belong to one of the instance's associated domains
(primary or satellite); otherwise the redirect will be rejected when the
task ticket is consumed. | +| `session_max_duration_in_seconds` | *Optional[int]* | :heavy_minus_sign: | The maximum duration that the session which will be created by the generated agent task should last.
By default, the duration of a session created via an agent task lasts 30 minutes. | \ No newline at end of file diff --git a/docs/models/createapikeyobject.md b/docs/models/createapikeyobject.md index ddea3ecc..8072fb2d 100644 --- a/docs/models/createapikeyobject.md +++ b/docs/models/createapikeyobject.md @@ -1,5 +1,13 @@ # CreateAPIKeyObject +## Example Usage + +```python +from clerk_backend_api.models import CreateAPIKeyObject + +value = CreateAPIKeyObject.API_KEY +``` + ## Values diff --git a/docs/models/createbulkinvitationstemplateslug.md b/docs/models/createbulkinvitationstemplateslug.md index 41580c50..54d4caa7 100644 --- a/docs/models/createbulkinvitationstemplateslug.md +++ b/docs/models/createbulkinvitationstemplateslug.md @@ -2,6 +2,14 @@ The slug of the email template to use for the invitation email. +## Example Usage + +```python +from clerk_backend_api.models import CreateBulkInvitationsTemplateSlug + +value = CreateBulkInvitationsTemplateSlug.INVITATION +``` + ## Values diff --git a/docs/models/createm2mtokenobject.md b/docs/models/createm2mtokenobject.md index 5b97627c..e6180fde 100644 --- a/docs/models/createm2mtokenobject.md +++ b/docs/models/createm2mtokenobject.md @@ -1,5 +1,13 @@ # CreateM2MTokenObject +## Example Usage + +```python +from clerk_backend_api.models import CreateM2MTokenObject + +value = CreateM2MTokenObject.MACHINE_TO_MACHINE_TOKEN +``` + ## Values diff --git a/docs/models/createm2mtokenrequestbody.md b/docs/models/createm2mtokenrequestbody.md index 6fbf1e69..d2c2523c 100644 --- a/docs/models/createm2mtokenrequestbody.md +++ b/docs/models/createm2mtokenrequestbody.md @@ -3,7 +3,8 @@ ## Fields -| Field | Type | Required | Description | -| -------------------------- | -------------------------- | -------------------------- | -------------------------- | -| `seconds_until_expiration` | *OptionalNullable[float]* | :heavy_minus_sign: | N/A | -| `claims` | *OptionalNullable[Any]* | :heavy_minus_sign: | N/A | \ No newline at end of file +| Field | Type | Required | Description | +| -------------------------------------------------------- | -------------------------------------------------------- | -------------------------------------------------------- | -------------------------------------------------------- | +| `token_format` | [Optional[models.TokenFormat]](../models/tokenformat.md) | :heavy_minus_sign: | N/A | +| `seconds_until_expiration` | *OptionalNullable[float]* | :heavy_minus_sign: | N/A | +| `claims` | *OptionalNullable[Any]* | :heavy_minus_sign: | N/A | \ No newline at end of file diff --git a/docs/models/createrolesettype.md b/docs/models/createrolesettype.md index 7b54ed42..bfadde58 100644 --- a/docs/models/createrolesettype.md +++ b/docs/models/createrolesettype.md @@ -3,6 +3,14 @@ The type of the role set. "initial" role sets are the default for new organizations. Only one role set can be "initial" per instance. +## Example Usage + +```python +from clerk_backend_api.models import CreateRoleSetType + +value = CreateRoleSetType.INITIAL +``` + ## Values diff --git a/docs/models/createsessiontokenfromtemplateobject.md b/docs/models/createsessiontokenfromtemplateobject.md index 6563205f..0e8ff12d 100644 --- a/docs/models/createsessiontokenfromtemplateobject.md +++ b/docs/models/createsessiontokenfromtemplateobject.md @@ -1,5 +1,13 @@ # CreateSessionTokenFromTemplateObject +## Example Usage + +```python +from clerk_backend_api.models import CreateSessionTokenFromTemplateObject + +value = CreateSessionTokenFromTemplateObject.TOKEN +``` + ## Values diff --git a/docs/models/createsessiontokenobject.md b/docs/models/createsessiontokenobject.md index 67d8fcf6..31df2dc2 100644 --- a/docs/models/createsessiontokenobject.md +++ b/docs/models/createsessiontokenobject.md @@ -1,5 +1,13 @@ # CreateSessionTokenObject +## Example Usage + +```python +from clerk_backend_api.models import CreateSessionTokenObject + +value = CreateSessionTokenObject.TOKEN +``` + ## Values diff --git a/docs/models/credits.md b/docs/models/credits.md new file mode 100644 index 00000000..2462c6f9 --- /dev/null +++ b/docs/models/credits.md @@ -0,0 +1,12 @@ +# Credits + +Unified credits breakdown for this subscription item. + + +## Fields + +| Field | Type | Required | Description | +| -------------------------------------------------------------------------------------------- | -------------------------------------------------------------------------------------------- | -------------------------------------------------------------------------------------------- | -------------------------------------------------------------------------------------------- | +| `proration` | [Nullable[models.Proration]](../models/proration.md) | :heavy_check_mark: | N/A | +| `payer` | [Nullable[models.CommerceSubscriptionItemPayer]](../models/commercesubscriptionitempayer.md) | :heavy_check_mark: | N/A | +| `total` | [models.CommerceMoneyResponse](../models/commercemoneyresponse.md) | :heavy_check_mark: | N/A | \ No newline at end of file diff --git a/docs/models/deleteapikeyobject.md b/docs/models/deleteapikeyobject.md index b0da6710..4913eeba 100644 --- a/docs/models/deleteapikeyobject.md +++ b/docs/models/deleteapikeyobject.md @@ -1,5 +1,13 @@ # DeleteAPIKeyObject +## Example Usage + +```python +from clerk_backend_api.models import DeleteAPIKeyObject + +value = DeleteAPIKeyObject.API_KEY +``` + ## Values diff --git a/docs/models/domainobject.md b/docs/models/domainobject.md index 893b03e3..c5fe0d03 100644 --- a/docs/models/domainobject.md +++ b/docs/models/domainobject.md @@ -1,5 +1,13 @@ # DomainObject +## Example Usage + +```python +from clerk_backend_api.models import DomainObject + +value = DomainObject.DOMAIN +``` + ## Values diff --git a/docs/models/domainsenrollmentmodes.md b/docs/models/domainsenrollmentmodes.md index 5af92ef4..adb54096 100644 --- a/docs/models/domainsenrollmentmodes.md +++ b/docs/models/domainsenrollmentmodes.md @@ -1,5 +1,13 @@ # DomainsEnrollmentModes +## Example Usage + +```python +from clerk_backend_api.models import DomainsEnrollmentModes + +value = DomainsEnrollmentModes.MANUAL_INVITATION +``` + ## Values diff --git a/docs/models/effectivemode.md b/docs/models/effectivemode.md index 2bca7a10..11d39aa3 100644 --- a/docs/models/effectivemode.md +++ b/docs/models/effectivemode.md @@ -2,6 +2,14 @@ When the new price takes effect. +## Example Usage + +```python +from clerk_backend_api.models import EffectiveMode + +value = EffectiveMode.IMMEDIATE +``` + ## Values diff --git a/docs/models/emailaddressobject.md b/docs/models/emailaddressobject.md index d04e242e..e0368673 100644 --- a/docs/models/emailaddressobject.md +++ b/docs/models/emailaddressobject.md @@ -3,6 +3,16 @@ String representing the object's type. Objects of the same type share the same value. +## Example Usage + +```python +from clerk_backend_api.models import EmailAddressObject + +value = EmailAddressObject.EMAIL_ADDRESS + +# Open enum: unrecognized values are captured as UnrecognizedStr +``` + ## Values diff --git a/docs/models/enrollmentmode.md b/docs/models/enrollmentmode.md index 6888eb23..91902752 100644 --- a/docs/models/enrollmentmode.md +++ b/docs/models/enrollmentmode.md @@ -2,6 +2,14 @@ Mode of enrollment for the domain +## Example Usage + +```python +from clerk_backend_api.models import EnrollmentMode + +value = EnrollmentMode.MANUAL_INVITATION +``` + ## Values diff --git a/docs/models/enterpriseaccountobject.md b/docs/models/enterpriseaccountobject.md index af4241d3..d3f2c23c 100644 --- a/docs/models/enterpriseaccountobject.md +++ b/docs/models/enterpriseaccountobject.md @@ -3,6 +3,14 @@ String representing the object's type. Objects of the same type share the same value. +## Example Usage + +```python +from clerk_backend_api.models import EnterpriseAccountObject + +value = EnterpriseAccountObject.ENTERPRISE_ACCOUNT +``` + ## Values diff --git a/docs/models/externalaccountwithverificationobject.md b/docs/models/externalaccountwithverificationobject.md index 6c3c2d4c..b5861d28 100644 --- a/docs/models/externalaccountwithverificationobject.md +++ b/docs/models/externalaccountwithverificationobject.md @@ -2,6 +2,14 @@ String representing the object's type. Objects of the same type share the same value. +## Example Usage + +```python +from clerk_backend_api.models import ExternalAccountWithVerificationObject + +value = ExternalAccountWithVerificationObject.EXTERNAL_ACCOUNT +``` + ## Values diff --git a/docs/models/featureresponseobject.md b/docs/models/featureresponseobject.md index 6b2e313c..a6529cbe 100644 --- a/docs/models/featureresponseobject.md +++ b/docs/models/featureresponseobject.md @@ -2,6 +2,14 @@ String representing the object's type. Objects of the same type share the same value. +## Example Usage + +```python +from clerk_backend_api.models import FeatureResponseObject + +value = FeatureResponseObject.FEATURE +``` + ## Values diff --git a/docs/models/format_.md b/docs/models/format_.md index d424ad00..0c89d998 100644 --- a/docs/models/format_.md +++ b/docs/models/format_.md @@ -2,6 +2,14 @@ The format of the response. +## Example Usage + +```python +from clerk_backend_api.models import Format + +value = Format.TOKEN +``` + ## Values diff --git a/docs/models/getapikeyobject.md b/docs/models/getapikeyobject.md index 789c9efd..e65ec6e0 100644 --- a/docs/models/getapikeyobject.md +++ b/docs/models/getapikeyobject.md @@ -1,5 +1,13 @@ # GetAPIKeyObject +## Example Usage + +```python +from clerk_backend_api.models import GetAPIKeyObject + +value = GetAPIKeyObject.API_KEY +``` + ## Values diff --git a/docs/models/getapikeysobject.md b/docs/models/getapikeysobject.md index c794eba2..731ad259 100644 --- a/docs/models/getapikeysobject.md +++ b/docs/models/getapikeysobject.md @@ -1,5 +1,13 @@ # GetAPIKeysObject +## Example Usage + +```python +from clerk_backend_api.models import GetAPIKeysObject + +value = GetAPIKeysObject.API_KEY +``` + ## Values diff --git a/docs/models/getcommercesubscriptionitemlistqueryparamstatus.md b/docs/models/getcommercesubscriptionitemlistqueryparamstatus.md index 409ddfa0..3eba9ece 100644 --- a/docs/models/getcommercesubscriptionitemlistqueryparamstatus.md +++ b/docs/models/getcommercesubscriptionitemlistqueryparamstatus.md @@ -2,6 +2,14 @@ Filter subscription items by status +## Example Usage + +```python +from clerk_backend_api.models import GetCommerceSubscriptionItemListQueryParamStatus + +value = GetCommerceSubscriptionItemListQueryParamStatus.ACTIVE +``` + ## Values diff --git a/docs/models/getm2mtokensobject.md b/docs/models/getm2mtokensobject.md index 30dd93b3..22790aeb 100644 --- a/docs/models/getm2mtokensobject.md +++ b/docs/models/getm2mtokensobject.md @@ -1,5 +1,13 @@ # GetM2MTokensObject +## Example Usage + +```python +from clerk_backend_api.models import GetM2MTokensObject + +value = GetM2MTokensObject.MACHINE_TO_MACHINE_TOKEN +``` + ## Values diff --git a/docs/models/getorganizationbillingcreditbalancerequest.md b/docs/models/getorganizationbillingcreditbalancerequest.md new file mode 100644 index 00000000..b8d5f2db --- /dev/null +++ b/docs/models/getorganizationbillingcreditbalancerequest.md @@ -0,0 +1,8 @@ +# GetOrganizationBillingCreditBalanceRequest + + +## Fields + +| Field | Type | Required | Description | +| ----------------------------------------------------------- | ----------------------------------------------------------- | ----------------------------------------------------------- | ----------------------------------------------------------- | +| `organization_id` | *str* | :heavy_check_mark: | The ID of the organization whose credit balance to retrieve | \ No newline at end of file diff --git a/docs/models/getuserbillingcreditbalancerequest.md b/docs/models/getuserbillingcreditbalancerequest.md new file mode 100644 index 00000000..39e61beb --- /dev/null +++ b/docs/models/getuserbillingcreditbalancerequest.md @@ -0,0 +1,8 @@ +# GetUserBillingCreditBalanceRequest + + +## Fields + +| Field | Type | Required | Description | +| --------------------------------------------------- | --------------------------------------------------- | --------------------------------------------------- | --------------------------------------------------- | +| `user_id` | *str* | :heavy_check_mark: | The ID of the user whose credit balance to retrieve | \ No newline at end of file diff --git a/docs/models/identifiertype.md b/docs/models/identifiertype.md index 40d4d41e..54d3d9cf 100644 --- a/docs/models/identifiertype.md +++ b/docs/models/identifiertype.md @@ -1,5 +1,13 @@ # IdentifierType +## Example Usage + +```python +from clerk_backend_api.models import IdentifierType + +value = IdentifierType.EMAIL_ADDRESS +``` + ## Values diff --git a/docs/models/includeinvalid.md b/docs/models/includeinvalid.md index 01f71cea..b48357a4 100644 --- a/docs/models/includeinvalid.md +++ b/docs/models/includeinvalid.md @@ -1,5 +1,13 @@ # IncludeInvalid +## Example Usage + +```python +from clerk_backend_api.models import IncludeInvalid + +value = IncludeInvalid.TRUE +``` + ## Values diff --git a/docs/models/instanceobject.md b/docs/models/instanceobject.md index 808ebf94..5c708611 100644 --- a/docs/models/instanceobject.md +++ b/docs/models/instanceobject.md @@ -2,6 +2,14 @@ String representing the object's type. Objects of the same type share the same value. +## Example Usage + +```python +from clerk_backend_api.models import InstanceObject + +value = InstanceObject.INSTANCE +``` + ## Values diff --git a/docs/models/instanceprotectobject.md b/docs/models/instanceprotectobject.md index 78515e94..ee0b461f 100644 --- a/docs/models/instanceprotectobject.md +++ b/docs/models/instanceprotectobject.md @@ -1,5 +1,13 @@ # InstanceProtectObject +## Example Usage + +```python +from clerk_backend_api.models import InstanceProtectObject + +value = InstanceProtectObject.INSTANCE_PROTECT +``` + ## Values diff --git a/docs/models/instancerestrictionsobject.md b/docs/models/instancerestrictionsobject.md index 142f45a7..5d0d0907 100644 --- a/docs/models/instancerestrictionsobject.md +++ b/docs/models/instancerestrictionsobject.md @@ -2,6 +2,14 @@ String representing the object's type. Objects of the same type share the same value. +## Example Usage + +```python +from clerk_backend_api.models import InstanceRestrictionsObject + +value = InstanceRestrictionsObject.INSTANCE_RESTRICTIONS +``` + ## Values diff --git a/docs/models/instancesettingsobject.md b/docs/models/instancesettingsobject.md index 0b1bac61..927d0b26 100644 --- a/docs/models/instancesettingsobject.md +++ b/docs/models/instancesettingsobject.md @@ -2,6 +2,14 @@ String representing the object's type. Objects of the same type share the same value. +## Example Usage + +```python +from clerk_backend_api.models import InstanceSettingsObject + +value = InstanceSettingsObject.INSTANCE_SETTINGS +``` + ## Values diff --git a/docs/models/invitationobject.md b/docs/models/invitationobject.md index c70a8642..521ac89e 100644 --- a/docs/models/invitationobject.md +++ b/docs/models/invitationobject.md @@ -1,5 +1,13 @@ # InvitationObject +## Example Usage + +```python +from clerk_backend_api.models import InvitationObject + +value = InvitationObject.INVITATION +``` + ## Values diff --git a/docs/models/invitationrevokedobject.md b/docs/models/invitationrevokedobject.md index 8e8675f3..bde48c3d 100644 --- a/docs/models/invitationrevokedobject.md +++ b/docs/models/invitationrevokedobject.md @@ -1,5 +1,13 @@ # InvitationRevokedObject +## Example Usage + +```python +from clerk_backend_api.models import InvitationRevokedObject + +value = InvitationRevokedObject.INVITATION +``` + ## Values diff --git a/docs/models/invitationrevokedstatus.md b/docs/models/invitationrevokedstatus.md index 36eda6ad..4517a280 100644 --- a/docs/models/invitationrevokedstatus.md +++ b/docs/models/invitationrevokedstatus.md @@ -1,5 +1,13 @@ # InvitationRevokedStatus +## Example Usage + +```python +from clerk_backend_api.models import InvitationRevokedStatus + +value = InvitationRevokedStatus.REVOKED +``` + ## Values diff --git a/docs/models/invitationstatus.md b/docs/models/invitationstatus.md index 9d487c02..8d6f95e9 100644 --- a/docs/models/invitationstatus.md +++ b/docs/models/invitationstatus.md @@ -1,5 +1,13 @@ # InvitationStatus +## Example Usage + +```python +from clerk_backend_api.models import InvitationStatus + +value = InvitationStatus.PENDING +``` + ## Values diff --git a/docs/models/jwttemplateobject.md b/docs/models/jwttemplateobject.md index 707c0e14..a65413c3 100644 --- a/docs/models/jwttemplateobject.md +++ b/docs/models/jwttemplateobject.md @@ -1,5 +1,13 @@ # JWTTemplateObject +## Example Usage + +```python +from clerk_backend_api.models import JWTTemplateObject + +value = JWTTemplateObject.JWT_TEMPLATE +``` + ## Values diff --git a/docs/models/listinstanceorganizationinvitationsqueryparamstatus.md b/docs/models/listinstanceorganizationinvitationsqueryparamstatus.md index 8c478eb4..ceddcad9 100644 --- a/docs/models/listinstanceorganizationinvitationsqueryparamstatus.md +++ b/docs/models/listinstanceorganizationinvitationsqueryparamstatus.md @@ -2,6 +2,14 @@ Filter organization invitations based on their status +## Example Usage + +```python +from clerk_backend_api.models import ListInstanceOrganizationInvitationsQueryParamStatus + +value = ListInstanceOrganizationInvitationsQueryParamStatus.PENDING +``` + ## Values @@ -9,4 +17,5 @@ Filter organization invitations based on their status | ---------- | ---------- | | `PENDING` | pending | | `ACCEPTED` | accepted | -| `REVOKED` | revoked | \ No newline at end of file +| `REVOKED` | revoked | +| `EXPIRED` | expired | \ No newline at end of file diff --git a/docs/models/listinvitationsqueryparamstatus.md b/docs/models/listinvitationsqueryparamstatus.md index 610b2d6d..ac0b6053 100644 --- a/docs/models/listinvitationsqueryparamstatus.md +++ b/docs/models/listinvitationsqueryparamstatus.md @@ -2,6 +2,14 @@ Filter invitations based on their status +## Example Usage + +```python +from clerk_backend_api.models import ListInvitationsQueryParamStatus + +value = ListInvitationsQueryParamStatus.PENDING +``` + ## Values diff --git a/docs/models/listorganizationinvitationsqueryparamstatus.md b/docs/models/listorganizationinvitationsqueryparamstatus.md index f7d02255..218f7552 100644 --- a/docs/models/listorganizationinvitationsqueryparamstatus.md +++ b/docs/models/listorganizationinvitationsqueryparamstatus.md @@ -2,6 +2,14 @@ Filter organization invitations based on their status +## Example Usage + +```python +from clerk_backend_api.models import ListOrganizationInvitationsQueryParamStatus + +value = ListOrganizationInvitationsQueryParamStatus.PENDING +``` + ## Values @@ -9,4 +17,5 @@ Filter organization invitations based on their status | ---------- | ---------- | | `PENDING` | pending | | `ACCEPTED` | accepted | -| `REVOKED` | revoked | \ No newline at end of file +| `REVOKED` | revoked | +| `EXPIRED` | expired | \ No newline at end of file diff --git a/docs/models/listwaitlistentriesqueryparamstatus.md b/docs/models/listwaitlistentriesqueryparamstatus.md index 4400e155..6c0eac2f 100644 --- a/docs/models/listwaitlistentriesqueryparamstatus.md +++ b/docs/models/listwaitlistentriesqueryparamstatus.md @@ -2,6 +2,14 @@ Filter waitlist entries by their status +## Example Usage + +```python +from clerk_backend_api.models import ListWaitlistEntriesQueryParamStatus + +value = ListWaitlistEntriesQueryParamStatus.PENDING +``` + ## Values diff --git a/docs/models/machinecreatedobject.md b/docs/models/machinecreatedobject.md index ea11e95d..ca89ce84 100644 --- a/docs/models/machinecreatedobject.md +++ b/docs/models/machinecreatedobject.md @@ -1,5 +1,13 @@ # MachineCreatedObject +## Example Usage + +```python +from clerk_backend_api.models import MachineCreatedObject + +value = MachineCreatedObject.MACHINE +``` + ## Values diff --git a/docs/models/machinedeletedobject.md b/docs/models/machinedeletedobject.md index ae27910a..2012ca03 100644 --- a/docs/models/machinedeletedobject.md +++ b/docs/models/machinedeletedobject.md @@ -2,6 +2,14 @@ String representing the object's type. +## Example Usage + +```python +from clerk_backend_api.models import MachineDeletedObject + +value = MachineDeletedObject.MACHINE +``` + ## Values diff --git a/docs/models/machineobject.md b/docs/models/machineobject.md index 5f26e764..2f113fe6 100644 --- a/docs/models/machineobject.md +++ b/docs/models/machineobject.md @@ -1,5 +1,13 @@ # MachineObject +## Example Usage + +```python +from clerk_backend_api.models import MachineObject + +value = MachineObject.MACHINE +``` + ## Values diff --git a/docs/models/machinescopedeletedobject.md b/docs/models/machinescopedeletedobject.md index 59c4cea5..8bc5f0d6 100644 --- a/docs/models/machinescopedeletedobject.md +++ b/docs/models/machinescopedeletedobject.md @@ -2,6 +2,14 @@ String representing the object's type. +## Example Usage + +```python +from clerk_backend_api.models import MachineScopeDeletedObject + +value = MachineScopeDeletedObject.MACHINE_SCOPE +``` + ## Values diff --git a/docs/models/machinescopeobject.md b/docs/models/machinescopeobject.md index 1e04958a..73a55f12 100644 --- a/docs/models/machinescopeobject.md +++ b/docs/models/machinescopeobject.md @@ -1,5 +1,13 @@ # MachineScopeObject +## Example Usage + +```python +from clerk_backend_api.models import MachineScopeObject + +value = MachineScopeObject.MACHINE_SCOPE +``` + ## Values diff --git a/docs/models/machinesecretkeyobject.md b/docs/models/machinesecretkeyobject.md index fb2e5cae..c8de0597 100644 --- a/docs/models/machinesecretkeyobject.md +++ b/docs/models/machinesecretkeyobject.md @@ -2,6 +2,14 @@ String representing the object's type. +## Example Usage + +```python +from clerk_backend_api.models import MachineSecretKeyObject + +value = MachineSecretKeyObject.MACHINE_SECRET_KEY +``` + ## Values diff --git a/docs/models/machinewithoutscopedmachinesobject.md b/docs/models/machinewithoutscopedmachinesobject.md index b3a5083e..f61db252 100644 --- a/docs/models/machinewithoutscopedmachinesobject.md +++ b/docs/models/machinewithoutscopedmachinesobject.md @@ -1,5 +1,13 @@ # MachineWithoutScopedMachinesObject +## Example Usage + +```python +from clerk_backend_api.models import MachineWithoutScopedMachinesObject + +value = MachineWithoutScopedMachinesObject.MACHINE +``` + ## Values diff --git a/docs/models/nextaction.md b/docs/models/nextaction.md index 16ce049e..b6612778 100644 --- a/docs/models/nextaction.md +++ b/docs/models/nextaction.md @@ -1,5 +1,13 @@ # NextAction +## Example Usage + +```python +from clerk_backend_api.models import NextAction + +value = NextAction.NEEDS_PREPARE +``` + ## Values diff --git a/docs/models/nonce.md b/docs/models/nonce.md index 29706b11..ed1fc264 100644 --- a/docs/models/nonce.md +++ b/docs/models/nonce.md @@ -1,5 +1,13 @@ # Nonce +## Example Usage + +```python +from clerk_backend_api.models import Nonce + +value = Nonce.NONCE +``` + ## Values diff --git a/docs/models/oauthaccesstokenobject.md b/docs/models/oauthaccesstokenobject.md index 4ad2d007..d2e8f90a 100644 --- a/docs/models/oauthaccesstokenobject.md +++ b/docs/models/oauthaccesstokenobject.md @@ -1,5 +1,13 @@ # OAuthAccessTokenObject +## Example Usage + +```python +from clerk_backend_api.models import OAuthAccessTokenObject + +value = OAuthAccessTokenObject.OAUTH_ACCESS_TOKEN +``` + ## Values diff --git a/docs/models/oauthapplicationobject.md b/docs/models/oauthapplicationobject.md index a24dc967..f20ece29 100644 --- a/docs/models/oauthapplicationobject.md +++ b/docs/models/oauthapplicationobject.md @@ -1,5 +1,13 @@ # OAuthApplicationObject +## Example Usage + +```python +from clerk_backend_api.models import OAuthApplicationObject + +value = OAuthApplicationObject.OAUTH_APPLICATION +``` + ## Values diff --git a/docs/models/oauthapplicationsettings.md b/docs/models/oauthapplicationsettings.md new file mode 100644 index 00000000..13f4b778 --- /dev/null +++ b/docs/models/oauthapplicationsettings.md @@ -0,0 +1,12 @@ +# OAuthApplicationSettings + +Success + + +## Fields + +| Field | Type | Required | Description | +| ------------------------------------------------------------------------------------------------------- | ------------------------------------------------------------------------------------------------------- | ------------------------------------------------------------------------------------------------------- | ------------------------------------------------------------------------------------------------------- | +| `object` | [models.OAuthApplicationSettingsObject](../models/oauthapplicationsettingsobject.md) | :heavy_check_mark: | String representing the object's type. Objects of the same type share the same value. | +| `dynamic_oauth_client_registration` | *bool* | :heavy_check_mark: | Whether dynamic OAuth client registration is enabled for the instance (RFC 7591). | +| `oauth_jwt_access_tokens` | *bool* | :heavy_check_mark: | Whether OAuth JWT access tokens are enabled for the instance (disabled indicates opaque access tokens). | \ No newline at end of file diff --git a/docs/models/oauthapplicationsettingsobject.md b/docs/models/oauthapplicationsettingsobject.md new file mode 100644 index 00000000..f26add8e --- /dev/null +++ b/docs/models/oauthapplicationsettingsobject.md @@ -0,0 +1,18 @@ +# OAuthApplicationSettingsObject + +String representing the object's type. Objects of the same type share the same value. + +## Example Usage + +```python +from clerk_backend_api.models import OAuthApplicationSettingsObject + +value = OAuthApplicationSettingsObject.OAUTH_APPLICATION_SETTINGS +``` + + +## Values + +| Name | Value | +| ---------------------------- | ---------------------------- | +| `OAUTH_APPLICATION_SETTINGS` | oauth_application_settings | \ No newline at end of file diff --git a/docs/models/oauthapplicationwithsecretobject.md b/docs/models/oauthapplicationwithsecretobject.md index f3057526..36dc1daa 100644 --- a/docs/models/oauthapplicationwithsecretobject.md +++ b/docs/models/oauthapplicationwithsecretobject.md @@ -1,5 +1,13 @@ # OAuthApplicationWithSecretObject +## Example Usage + +```python +from clerk_backend_api.models import OAuthApplicationWithSecretObject + +value = OAuthApplicationWithSecretObject.OAUTH_APPLICATION +``` + ## Values diff --git a/docs/models/object.md b/docs/models/object.md index ec43ade1..bef0753e 100644 --- a/docs/models/object.md +++ b/docs/models/object.md @@ -3,6 +3,14 @@ String representing the object's type. Objects of the same type share the same value. +## Example Usage + +```python +from clerk_backend_api.models import Object + +value = Object.CLIENT +``` + ## Values diff --git a/docs/models/onbehalfof.md b/docs/models/onbehalfof.md new file mode 100644 index 00000000..409a83fe --- /dev/null +++ b/docs/models/onbehalfof.md @@ -0,0 +1,12 @@ +# OnBehalfOf + +Identifies the user on whose behalf the agent task is created. +Exactly one of user_id or identifier must be provided. + + +## Fields + +| Field | Type | Required | Description | +| ----------------------------------------------------------------- | ----------------------------------------------------------------- | ----------------------------------------------------------------- | ----------------------------------------------------------------- | +| `user_id` | *Optional[str]* | :heavy_minus_sign: | The ID of the user. | +| `identifier` | *Optional[str]* | :heavy_minus_sign: | A verified identifier (e.g. email address) belonging to the user. | \ No newline at end of file diff --git a/docs/models/organizationdomainobject.md b/docs/models/organizationdomainobject.md index 60cf4263..956eda3d 100644 --- a/docs/models/organizationdomainobject.md +++ b/docs/models/organizationdomainobject.md @@ -3,6 +3,14 @@ String representing the object's type. Objects of the same type share the same value. Always `organization_domain` +## Example Usage + +```python +from clerk_backend_api.models import OrganizationDomainObject + +value = OrganizationDomainObject.ORGANIZATION_DOMAIN +``` + ## Values diff --git a/docs/models/organizationdomainstatus.md b/docs/models/organizationdomainstatus.md index 1b2a5f0c..c4f60c55 100644 --- a/docs/models/organizationdomainstatus.md +++ b/docs/models/organizationdomainstatus.md @@ -2,6 +2,14 @@ Status of the verification. It can be `unverified` or `verified` +## Example Usage + +```python +from clerk_backend_api.models import OrganizationDomainStatus + +value = OrganizationDomainStatus.UNVERIFIED +``` + ## Values diff --git a/docs/models/organizationinvitationobject.md b/docs/models/organizationinvitationobject.md index be5a9710..00a4d681 100644 --- a/docs/models/organizationinvitationobject.md +++ b/docs/models/organizationinvitationobject.md @@ -3,6 +3,14 @@ String representing the object's type. Objects of the same type share the same value. +## Example Usage + +```python +from clerk_backend_api.models import OrganizationInvitationObject + +value = OrganizationInvitationObject.ORGANIZATION_INVITATION +``` + ## Values diff --git a/docs/models/organizationinvitationwithpublicorganizationdataobject.md b/docs/models/organizationinvitationwithpublicorganizationdataobject.md index f801fbde..f58d621f 100644 --- a/docs/models/organizationinvitationwithpublicorganizationdataobject.md +++ b/docs/models/organizationinvitationwithpublicorganizationdataobject.md @@ -3,6 +3,14 @@ String representing the object's type. Objects of the same type share the same value. +## Example Usage + +```python +from clerk_backend_api.models import OrganizationInvitationWithPublicOrganizationDataObject + +value = OrganizationInvitationWithPublicOrganizationDataObject.ORGANIZATION_INVITATION +``` + ## Values diff --git a/docs/models/organizationmembershipobject.md b/docs/models/organizationmembershipobject.md index b06b6f2c..b875c052 100644 --- a/docs/models/organizationmembershipobject.md +++ b/docs/models/organizationmembershipobject.md @@ -3,6 +3,14 @@ String representing the object's type. Objects of the same type share the same value. +## Example Usage + +```python +from clerk_backend_api.models import OrganizationMembershipObject + +value = OrganizationMembershipObject.ORGANIZATION_MEMBERSHIP +``` + ## Values diff --git a/docs/models/organizationmembershiporganizationobject.md b/docs/models/organizationmembershiporganizationobject.md index aa6222b0..b111087f 100644 --- a/docs/models/organizationmembershiporganizationobject.md +++ b/docs/models/organizationmembershiporganizationobject.md @@ -1,5 +1,13 @@ # OrganizationMembershipOrganizationObject +## Example Usage + +```python +from clerk_backend_api.models import OrganizationMembershipOrganizationObject + +value = OrganizationMembershipOrganizationObject.ORGANIZATION +``` + ## Values diff --git a/docs/models/organizationobject.md b/docs/models/organizationobject.md index 30e26e25..3f57c88f 100644 --- a/docs/models/organizationobject.md +++ b/docs/models/organizationobject.md @@ -1,5 +1,13 @@ # OrganizationObject +## Example Usage + +```python +from clerk_backend_api.models import OrganizationObject + +value = OrganizationObject.ORGANIZATION +``` + ## Values diff --git a/docs/models/organizationsettingsobject.md b/docs/models/organizationsettingsobject.md index 023bd087..1b8d964b 100644 --- a/docs/models/organizationsettingsobject.md +++ b/docs/models/organizationsettingsobject.md @@ -2,6 +2,14 @@ String representing the object's type. Objects of the same type share the same value. +## Example Usage + +```python +from clerk_backend_api.models import OrganizationSettingsObject + +value = OrganizationSettingsObject.ORGANIZATION_SETTINGS +``` + ## Values diff --git a/docs/models/organizationwithlogoobject.md b/docs/models/organizationwithlogoobject.md index cdb1d2e7..0b589c1e 100644 --- a/docs/models/organizationwithlogoobject.md +++ b/docs/models/organizationwithlogoobject.md @@ -1,5 +1,13 @@ # OrganizationWithLogoObject +## Example Usage + +```python +from clerk_backend_api.models import OrganizationWithLogoObject + +value = OrganizationWithLogoObject.ORGANIZATION +``` + ## Values diff --git a/docs/models/passkeyobject.md b/docs/models/passkeyobject.md index ea55ec21..328871e1 100644 --- a/docs/models/passkeyobject.md +++ b/docs/models/passkeyobject.md @@ -3,6 +3,14 @@ String representing the object's type. Objects of the same type share the same value. +## Example Usage + +```python +from clerk_backend_api.models import PasskeyObject + +value = PasskeyObject.PASSKEY +``` + ## Values diff --git a/docs/models/pathparamtemplatetype.md b/docs/models/pathparamtemplatetype.md index 2646b2f9..90fe89fc 100644 --- a/docs/models/pathparamtemplatetype.md +++ b/docs/models/pathparamtemplatetype.md @@ -2,6 +2,14 @@ The type of templates to retrieve (email or SMS) +## Example Usage + +```python +from clerk_backend_api.models import PathParamTemplateType + +value = PathParamTemplateType.EMAIL +``` + ## Values diff --git a/docs/models/payertype.md b/docs/models/payertype.md index 69c1247b..51cb168c 100644 --- a/docs/models/payertype.md +++ b/docs/models/payertype.md @@ -2,6 +2,14 @@ Filter plans by payer type +## Example Usage + +```python +from clerk_backend_api.models import PayerType + +value = PayerType.USER +``` + ## Values diff --git a/docs/models/paymentmethod.md b/docs/models/paymentmethod.md index da0b507b..54085679 100644 --- a/docs/models/paymentmethod.md +++ b/docs/models/paymentmethod.md @@ -2,6 +2,14 @@ The payment method type. +## Example Usage + +```python +from clerk_backend_api.models import PaymentMethod + +value = PaymentMethod.CARD +``` + ## Values diff --git a/docs/models/paymenttype.md b/docs/models/paymenttype.md index 809cad06..3a42efd2 100644 --- a/docs/models/paymenttype.md +++ b/docs/models/paymenttype.md @@ -2,6 +2,14 @@ The payment method type. +## Example Usage + +```python +from clerk_backend_api.models import PaymentType + +value = PaymentType.CARD +``` + ## Values diff --git a/docs/models/permissionobject.md b/docs/models/permissionobject.md index 13f12200..481a07ba 100644 --- a/docs/models/permissionobject.md +++ b/docs/models/permissionobject.md @@ -1,5 +1,13 @@ # PermissionObject +## Example Usage + +```python +from clerk_backend_api.models import PermissionObject + +value = PermissionObject.PERMISSION +``` + ## Values diff --git a/docs/models/phonenumberobject.md b/docs/models/phonenumberobject.md index 18fc0c38..3435d90b 100644 --- a/docs/models/phonenumberobject.md +++ b/docs/models/phonenumberobject.md @@ -3,6 +3,14 @@ String representing the object's type. Objects of the same type share the same value. +## Example Usage + +```python +from clerk_backend_api.models import PhoneNumberObject + +value = PhoneNumberObject.PHONE_NUMBER +``` + ## Values diff --git a/docs/models/plan.md b/docs/models/plan.md index b2e5b272..c07c6b8c 100644 --- a/docs/models/plan.md +++ b/docs/models/plan.md @@ -24,4 +24,5 @@ The associated plan. | `avatar_url` | *Nullable[str]* | :heavy_check_mark: | The URL of the plan's avatar image. | | `features` | List[[models.FeatureResponse](../models/featureresponse.md)] | :heavy_minus_sign: | The features included in this plan. | | `free_trial_enabled` | *bool* | :heavy_check_mark: | Whether free trial is enabled for this plan. | -| `free_trial_days` | *Nullable[int]* | :heavy_check_mark: | Number of free trial days for this plan. | \ No newline at end of file +| `free_trial_days` | *Nullable[int]* | :heavy_check_mark: | Number of free trial days for this plan. | +| `unit_prices` | List[[models.CommercePlanUnitPrice](../models/commerceplanunitprice.md)] | :heavy_minus_sign: | Per-unit pricing tiers for this plan (for example, seats) | \ No newline at end of file diff --git a/docs/models/planperiod.md b/docs/models/planperiod.md index 7f962d24..abca4ed5 100644 --- a/docs/models/planperiod.md +++ b/docs/models/planperiod.md @@ -2,6 +2,14 @@ The billing period for this subscription item. +## Example Usage + +```python +from clerk_backend_api.models import PlanPeriod + +value = PlanPeriod.MONTH +``` + ## Values diff --git a/docs/models/previoussubscriptionitemstatus.md b/docs/models/previoussubscriptionitemstatus.md index 86033b30..4f84feb1 100644 --- a/docs/models/previoussubscriptionitemstatus.md +++ b/docs/models/previoussubscriptionitemstatus.md @@ -2,6 +2,14 @@ The status of the previous subscription item after transition. +## Example Usage + +```python +from clerk_backend_api.models import PreviousSubscriptionItemStatus + +value = PreviousSubscriptionItemStatus.CANCELED +``` + ## Values diff --git a/docs/models/proration.md b/docs/models/proration.md new file mode 100644 index 00000000..0082460c --- /dev/null +++ b/docs/models/proration.md @@ -0,0 +1,11 @@ +# Proration + + +## Fields + +| Field | Type | Required | Description | +| ------------------------------------------------------------------ | ------------------------------------------------------------------ | ------------------------------------------------------------------ | ------------------------------------------------------------------ | +| `amount` | [models.CommerceMoneyResponse](../models/commercemoneyresponse.md) | :heavy_check_mark: | N/A | +| `cycle_days_remaining` | *int* | :heavy_check_mark: | N/A | +| `cycle_days_total` | *int* | :heavy_check_mark: | N/A | +| `cycle_remaining_percent` | *float* | :heavy_check_mark: | N/A | \ No newline at end of file diff --git a/docs/models/protocol.md b/docs/models/protocol.md index caea7e3f..aac70bef 100644 --- a/docs/models/protocol.md +++ b/docs/models/protocol.md @@ -3,6 +3,14 @@ The authentication protocol used to sign in. +## Example Usage + +```python +from clerk_backend_api.models import Protocol + +value = Protocol.OAUTH +``` + ## Values diff --git a/docs/models/provider.md b/docs/models/provider.md index 1bed0471..1e9ad00b 100644 --- a/docs/models/provider.md +++ b/docs/models/provider.md @@ -2,6 +2,14 @@ The IdP provider of the connection. +## Example Usage + +```python +from clerk_backend_api.models import Provider + +value = Provider.SAML_CUSTOM +``` + ## Values diff --git a/docs/models/proxycheckobject.md b/docs/models/proxycheckobject.md index 8f072d3b..517f4ec8 100644 --- a/docs/models/proxycheckobject.md +++ b/docs/models/proxycheckobject.md @@ -1,5 +1,13 @@ # ProxyCheckObject +## Example Usage + +```python +from clerk_backend_api.models import ProxyCheckObject + +value = ProxyCheckObject.PROXY_CHECK +``` + ## Values diff --git a/docs/models/queryparamenrollmentmode.md b/docs/models/queryparamenrollmentmode.md index 57f06cd8..a318c83a 100644 --- a/docs/models/queryparamenrollmentmode.md +++ b/docs/models/queryparamenrollmentmode.md @@ -1,5 +1,13 @@ # QueryParamEnrollmentMode +## Example Usage + +```python +from clerk_backend_api.models import QueryParamEnrollmentMode + +value = QueryParamEnrollmentMode.MANUAL_INVITATION +``` + ## Values diff --git a/docs/models/queryparampayertype.md b/docs/models/queryparampayertype.md index b1d66d8b..c3ba3006 100644 --- a/docs/models/queryparampayertype.md +++ b/docs/models/queryparampayertype.md @@ -2,6 +2,14 @@ Filter subscription items by payer type +## Example Usage + +```python +from clerk_backend_api.models import QueryParamPayerType + +value = QueryParamPayerType.USER +``` + ## Values diff --git a/docs/models/queryparamstatus.md b/docs/models/queryparamstatus.md index 69b7e96a..e7a27179 100644 --- a/docs/models/queryparamstatus.md +++ b/docs/models/queryparamstatus.md @@ -2,6 +2,14 @@ Filter sessions by the provided status +## Example Usage + +```python +from clerk_backend_api.models import QueryParamStatus + +value = QueryParamStatus.ABANDONED +``` + ## Values diff --git a/docs/models/redirecturlobject.md b/docs/models/redirecturlobject.md index 5007ef4d..27d149a2 100644 --- a/docs/models/redirecturlobject.md +++ b/docs/models/redirecturlobject.md @@ -1,5 +1,13 @@ # RedirectURLObject +## Example Usage + +```python +from clerk_backend_api.models import RedirectURLObject + +value = RedirectURLObject.REDIRECT_URL +``` + ## Values diff --git a/docs/models/requestbodyprovider.md b/docs/models/requestbodyprovider.md index f2ff5f03..3234d33e 100644 --- a/docs/models/requestbodyprovider.md +++ b/docs/models/requestbodyprovider.md @@ -2,6 +2,14 @@ The IdP provider of the connection. +## Example Usage + +```python +from clerk_backend_api.models import RequestBodyProvider + +value = RequestBodyProvider.SAML_CUSTOM +``` + ## Values diff --git a/docs/models/responsebodyobject.md b/docs/models/responsebodyobject.md index 1144fc3b..eb9ffa4a 100644 --- a/docs/models/responsebodyobject.md +++ b/docs/models/responsebodyobject.md @@ -1,5 +1,13 @@ # ResponseBodyObject +## Example Usage + +```python +from clerk_backend_api.models import ResponseBodyObject + +value = ResponseBodyObject.CLERK_IDP_OAUTH_ACCESS_TOKEN +``` + ## Values diff --git a/docs/models/reverttemplatepathparamtemplatetype.md b/docs/models/reverttemplatepathparamtemplatetype.md index f93ca382..37529e0f 100644 --- a/docs/models/reverttemplatepathparamtemplatetype.md +++ b/docs/models/reverttemplatepathparamtemplatetype.md @@ -2,6 +2,14 @@ The type of template to revert +## Example Usage + +```python +from clerk_backend_api.models import RevertTemplatePathParamTemplateType + +value = RevertTemplatePathParamTemplateType.EMAIL +``` + ## Values diff --git a/docs/models/revokeagenttaskrequest.md b/docs/models/revokeagenttaskrequest.md new file mode 100644 index 00000000..9ebff7f2 --- /dev/null +++ b/docs/models/revokeagenttaskrequest.md @@ -0,0 +1,8 @@ +# RevokeAgentTaskRequest + + +## Fields + +| Field | Type | Required | Description | +| --------------------------------------- | --------------------------------------- | --------------------------------------- | --------------------------------------- | +| `agent_task_id` | *str* | :heavy_check_mark: | The ID of the agent task to be revoked. | \ No newline at end of file diff --git a/docs/models/revokeapikeyobject.md b/docs/models/revokeapikeyobject.md index 14d79c39..2dfd8f1f 100644 --- a/docs/models/revokeapikeyobject.md +++ b/docs/models/revokeapikeyobject.md @@ -1,5 +1,13 @@ # RevokeAPIKeyObject +## Example Usage + +```python +from clerk_backend_api.models import RevokeAPIKeyObject + +value = RevokeAPIKeyObject.API_KEY +``` + ## Values diff --git a/docs/models/revokem2mtokenobject.md b/docs/models/revokem2mtokenobject.md index 9fdc2c8a..68372490 100644 --- a/docs/models/revokem2mtokenobject.md +++ b/docs/models/revokem2mtokenobject.md @@ -1,5 +1,13 @@ # RevokeM2MTokenObject +## Example Usage + +```python +from clerk_backend_api.models import RevokeM2MTokenObject + +value = RevokeM2MTokenObject.MACHINE_TO_MACHINE_TOKEN +``` + ## Values diff --git a/docs/models/roleobject.md b/docs/models/roleobject.md index a40d3286..c2b10a9c 100644 --- a/docs/models/roleobject.md +++ b/docs/models/roleobject.md @@ -1,5 +1,13 @@ # RoleObject +## Example Usage + +```python +from clerk_backend_api.models import RoleObject + +value = RoleObject.ROLE +``` + ## Values diff --git a/docs/models/rolesetcreatorroleobject.md b/docs/models/rolesetcreatorroleobject.md index a108279a..463e3b03 100644 --- a/docs/models/rolesetcreatorroleobject.md +++ b/docs/models/rolesetcreatorroleobject.md @@ -1,5 +1,13 @@ # RoleSetCreatorRoleObject +## Example Usage + +```python +from clerk_backend_api.models import RoleSetCreatorRoleObject + +value = RoleSetCreatorRoleObject.ROLE_SET_ITEM +``` + ## Values diff --git a/docs/models/rolesetdefaultroleobject.md b/docs/models/rolesetdefaultroleobject.md index 5df9b4c0..dcdc83bd 100644 --- a/docs/models/rolesetdefaultroleobject.md +++ b/docs/models/rolesetdefaultroleobject.md @@ -1,5 +1,13 @@ # RoleSetDefaultRoleObject +## Example Usage + +```python +from clerk_backend_api.models import RoleSetDefaultRoleObject + +value = RoleSetDefaultRoleObject.ROLE_SET_ITEM +``` + ## Values diff --git a/docs/models/rolesetitemobject.md b/docs/models/rolesetitemobject.md index f42ab724..4d159af4 100644 --- a/docs/models/rolesetitemobject.md +++ b/docs/models/rolesetitemobject.md @@ -1,5 +1,13 @@ # RoleSetItemObject +## Example Usage + +```python +from clerk_backend_api.models import RoleSetItemObject + +value = RoleSetItemObject.ROLE_SET_ITEM +``` + ## Values diff --git a/docs/models/rolesetobject.md b/docs/models/rolesetobject.md index 06fb7253..a8f9cd47 100644 --- a/docs/models/rolesetobject.md +++ b/docs/models/rolesetobject.md @@ -1,5 +1,13 @@ # RoleSetObject +## Example Usage + +```python +from clerk_backend_api.models import RoleSetObject + +value = RoleSetObject.ROLE_SET +``` + ## Values diff --git a/docs/models/rolesetrolesetmigrationobject.md b/docs/models/rolesetrolesetmigrationobject.md index 7449a0b3..071ceb3b 100644 --- a/docs/models/rolesetrolesetmigrationobject.md +++ b/docs/models/rolesetrolesetmigrationobject.md @@ -1,5 +1,13 @@ # RoleSetRoleSetMigrationObject +## Example Usage + +```python +from clerk_backend_api.models import RoleSetRoleSetMigrationObject + +value = RoleSetRoleSetMigrationObject.ROLE_SET_MIGRATION +``` + ## Values diff --git a/docs/models/samlaccountobject.md b/docs/models/samlaccountobject.md index f9930079..984038bc 100644 --- a/docs/models/samlaccountobject.md +++ b/docs/models/samlaccountobject.md @@ -3,6 +3,14 @@ String representing the object's type. Objects of the same type share the same value. +## Example Usage + +```python +from clerk_backend_api.models import SAMLAccountObject + +value = SAMLAccountObject.SAML_ACCOUNT +``` + ## Values diff --git a/docs/models/schemascommerceplanobject.md b/docs/models/schemascommerceplanobject.md index 0a914fbb..bfa7d74b 100644 --- a/docs/models/schemascommerceplanobject.md +++ b/docs/models/schemascommerceplanobject.md @@ -2,6 +2,14 @@ String representing the object's type. Objects of the same type share the same value. +## Example Usage + +```python +from clerk_backend_api.models import SchemasCommercePlanObject + +value = SchemasCommercePlanObject.COMMERCE_PLAN +``` + ## Values diff --git a/docs/models/schemascommercesubscriptionitemobject.md b/docs/models/schemascommercesubscriptionitemobject.md index 1ab632b6..f2090836 100644 --- a/docs/models/schemascommercesubscriptionitemobject.md +++ b/docs/models/schemascommercesubscriptionitemobject.md @@ -2,6 +2,14 @@ String representing the object's type. Objects of the same type share the same value. +## Example Usage + +```python +from clerk_backend_api.models import SchemasCommerceSubscriptionItemObject + +value = SchemasCommerceSubscriptionItemObject.COMMERCE_SUBSCRIPTION_ITEM +``` + ## Values diff --git a/docs/models/schemascommercesubscriptionitempayerobject.md b/docs/models/schemascommercesubscriptionitempayerobject.md index a5eb1eeb..6ccf67f2 100644 --- a/docs/models/schemascommercesubscriptionitempayerobject.md +++ b/docs/models/schemascommercesubscriptionitempayerobject.md @@ -2,6 +2,14 @@ String representing the object's type. Objects of the same type share the same value. +## Example Usage + +```python +from clerk_backend_api.models import SchemasCommerceSubscriptionItemPayerObject + +value = SchemasCommerceSubscriptionItemPayerObject.COMMERCE_PAYER +``` + ## Values diff --git a/docs/models/schemascommercesubscriptionitempaymentsourceobject.md b/docs/models/schemascommercesubscriptionitempaymentsourceobject.md index d0c5d679..3ae7b159 100644 --- a/docs/models/schemascommercesubscriptionitempaymentsourceobject.md +++ b/docs/models/schemascommercesubscriptionitempaymentsourceobject.md @@ -2,6 +2,14 @@ String representing the object's type. Objects of the same type share the same value. +## Example Usage + +```python +from clerk_backend_api.models import SchemasCommerceSubscriptionItemPaymentSourceObject + +value = SchemasCommerceSubscriptionItemPaymentSourceObject.COMMERCE_SOURCE +``` + ## Values diff --git a/docs/models/schemascommercesubscriptionitempaymentsourcestatus.md b/docs/models/schemascommercesubscriptionitempaymentsourcestatus.md index 9b95c8cf..edf81824 100644 --- a/docs/models/schemascommercesubscriptionitempaymentsourcestatus.md +++ b/docs/models/schemascommercesubscriptionitempaymentsourcestatus.md @@ -2,6 +2,14 @@ Status of the payment source. +## Example Usage + +```python +from clerk_backend_api.models import SchemasCommerceSubscriptionItemPaymentSourceStatus + +value = SchemasCommerceSubscriptionItemPaymentSourceStatus.ACTIVE +``` + ## Values diff --git a/docs/models/schemascommercesubscriptionitemplanobject.md b/docs/models/schemascommercesubscriptionitemplanobject.md index 90280e00..c6e97c10 100644 --- a/docs/models/schemascommercesubscriptionitemplanobject.md +++ b/docs/models/schemascommercesubscriptionitemplanobject.md @@ -2,6 +2,14 @@ String representing the object's type. Objects of the same type share the same value. +## Example Usage + +```python +from clerk_backend_api.models import SchemasCommerceSubscriptionItemPlanObject + +value = SchemasCommerceSubscriptionItemPlanObject.COMMERCE_PLAN +``` + ## Values diff --git a/docs/models/schemascommercesubscriptionitemplanperiod.md b/docs/models/schemascommercesubscriptionitemplanperiod.md index 89397967..42b3ae81 100644 --- a/docs/models/schemascommercesubscriptionitemplanperiod.md +++ b/docs/models/schemascommercesubscriptionitemplanperiod.md @@ -2,6 +2,14 @@ The billing period for this subscription. +## Example Usage + +```python +from clerk_backend_api.models import SchemasCommerceSubscriptionItemPlanPeriod + +value = SchemasCommerceSubscriptionItemPlanPeriod.MONTH +``` + ## Values diff --git a/docs/models/schemascommercesubscriptionitemstatus.md b/docs/models/schemascommercesubscriptionitemstatus.md index 0d6f6067..6e35d845 100644 --- a/docs/models/schemascommercesubscriptionitemstatus.md +++ b/docs/models/schemascommercesubscriptionitemstatus.md @@ -2,6 +2,14 @@ Current status of the subscription item. +## Example Usage + +```python +from clerk_backend_api.models import SchemasCommerceSubscriptionItemStatus + +value = SchemasCommerceSubscriptionItemStatus.ACTIVE +``` + ## Values diff --git a/docs/models/schemasfeatureresponseobject.md b/docs/models/schemasfeatureresponseobject.md index a8faeba5..62eeef00 100644 --- a/docs/models/schemasfeatureresponseobject.md +++ b/docs/models/schemasfeatureresponseobject.md @@ -2,6 +2,14 @@ String representing the object's type. Objects of the same type share the same value. +## Example Usage + +```python +from clerk_backend_api.models import SchemasFeatureResponseObject + +value = SchemasFeatureResponseObject.FEATURE +``` + ## Values diff --git a/docs/models/schemassamlconnection2object.md b/docs/models/schemassamlconnection2object.md index 4fb6f14e..99f400d6 100644 --- a/docs/models/schemassamlconnection2object.md +++ b/docs/models/schemassamlconnection2object.md @@ -1,5 +1,13 @@ # SchemasSAMLConnection2Object +## Example Usage + +```python +from clerk_backend_api.models import SchemasSAMLConnection2Object + +value = SchemasSAMLConnection2Object.SAML_CONNECTION +``` + ## Values diff --git a/docs/models/schemassamlconnectionobject.md b/docs/models/schemassamlconnectionobject.md index 2fa22f8a..db655468 100644 --- a/docs/models/schemassamlconnectionobject.md +++ b/docs/models/schemassamlconnectionobject.md @@ -1,5 +1,13 @@ # SchemasSAMLConnectionObject +## Example Usage + +```python +from clerk_backend_api.models import SchemasSAMLConnectionObject + +value = SchemasSAMLConnectionObject.SAML_CONNECTION +``` + ## Values diff --git a/docs/models/seats.md b/docs/models/seats.md new file mode 100644 index 00000000..52fd226b --- /dev/null +++ b/docs/models/seats.md @@ -0,0 +1,10 @@ +# Seats + +Seat quantity for seat-based billing. + + +## Fields + +| Field | Type | Required | Description | +| ------------------------------------------------ | ------------------------------------------------ | ------------------------------------------------ | ------------------------------------------------ | +| `quantity` | *Nullable[int]* | :heavy_check_mark: | Seat quantity being billed; null means unlimited | \ No newline at end of file diff --git a/docs/models/sessionobject.md b/docs/models/sessionobject.md index ff6d435b..dd2f6131 100644 --- a/docs/models/sessionobject.md +++ b/docs/models/sessionobject.md @@ -3,6 +3,14 @@ String representing the object's type. Objects of the same type share the same value. +## Example Usage + +```python +from clerk_backend_api.models import SessionObject + +value = SessionObject.SESSION +``` + ## Values diff --git a/docs/models/signintokenobject.md b/docs/models/signintokenobject.md index 51c2643d..a1f85dfb 100644 --- a/docs/models/signintokenobject.md +++ b/docs/models/signintokenobject.md @@ -1,5 +1,13 @@ # SignInTokenObject +## Example Usage + +```python +from clerk_backend_api.models import SignInTokenObject + +value = SignInTokenObject.SIGN_IN_TOKEN +``` + ## Values diff --git a/docs/models/signintokenstatus.md b/docs/models/signintokenstatus.md index d381a77f..7e1f9dd7 100644 --- a/docs/models/signintokenstatus.md +++ b/docs/models/signintokenstatus.md @@ -1,5 +1,13 @@ # SignInTokenStatus +## Example Usage + +```python +from clerk_backend_api.models import SignInTokenStatus + +value = SignInTokenStatus.PENDING +``` + ## Values diff --git a/docs/models/signupobject.md b/docs/models/signupobject.md index 15c23345..72457aed 100644 --- a/docs/models/signupobject.md +++ b/docs/models/signupobject.md @@ -1,5 +1,13 @@ # SignUpObject +## Example Usage + +```python +from clerk_backend_api.models import SignUpObject + +value = SignUpObject.SIGN_UP_ATTEMPT +``` + ## Values diff --git a/docs/models/signupstatus.md b/docs/models/signupstatus.md index 17a919bb..2035a09f 100644 --- a/docs/models/signupstatus.md +++ b/docs/models/signupstatus.md @@ -1,5 +1,13 @@ # SignUpStatus +## Example Usage + +```python +from clerk_backend_api.models import SignUpStatus + +value = SignUpStatus.MISSING_REQUIREMENTS +``` + ## Values diff --git a/docs/models/status.md b/docs/models/status.md index 5411a4c4..f2a4c7e8 100644 --- a/docs/models/status.md +++ b/docs/models/status.md @@ -1,5 +1,13 @@ # Status +## Example Usage + +```python +from clerk_backend_api.models import Status + +value = Status.ACTIVE +``` + ## Values diff --git a/docs/models/strategy.md b/docs/models/strategy.md index bba7efa9..3e586a08 100644 --- a/docs/models/strategy.md +++ b/docs/models/strategy.md @@ -1,5 +1,15 @@ # Strategy +## Example Usage + +```python +from clerk_backend_api.models import Strategy + +value = Strategy.PHONE_CODE + +# Open enum: unrecognized values are captured as UnrecognizedStr +``` + ## Values diff --git a/docs/models/templateobject.md b/docs/models/templateobject.md index 417d2a6b..e3221c9f 100644 --- a/docs/models/templateobject.md +++ b/docs/models/templateobject.md @@ -3,6 +3,14 @@ String representing the object's type. Objects of the same type share the same value. +## Example Usage + +```python +from clerk_backend_api.models import TemplateObject + +value = TemplateObject.TEMPLATE +``` + ## Values diff --git a/docs/models/templateslug.md b/docs/models/templateslug.md index c0b97dfd..d96836c2 100644 --- a/docs/models/templateslug.md +++ b/docs/models/templateslug.md @@ -2,6 +2,14 @@ The slug of the email template to use for the invitation email. +## Example Usage + +```python +from clerk_backend_api.models import TemplateSlug + +value = TemplateSlug.INVITATION +``` + ## Values diff --git a/docs/models/templatetype.md b/docs/models/templatetype.md index cabd96ac..74834f59 100644 --- a/docs/models/templatetype.md +++ b/docs/models/templatetype.md @@ -2,6 +2,14 @@ The type of templates to list (email or SMS) +## Example Usage + +```python +from clerk_backend_api.models import TemplateType + +value = TemplateType.EMAIL +``` + ## Values diff --git a/docs/models/testingtokenobject.md b/docs/models/testingtokenobject.md index a9dd8c0f..f5ceff13 100644 --- a/docs/models/testingtokenobject.md +++ b/docs/models/testingtokenobject.md @@ -1,5 +1,13 @@ # TestingTokenObject +## Example Usage + +```python +from clerk_backend_api.models import TestingTokenObject + +value = TestingTokenObject.TESTING_TOKEN +``` + ## Values diff --git a/docs/models/toggletemplatedeliverypathparamtemplatetype.md b/docs/models/toggletemplatedeliverypathparamtemplatetype.md index 11aebaf5..8711c00f 100644 --- a/docs/models/toggletemplatedeliverypathparamtemplatetype.md +++ b/docs/models/toggletemplatedeliverypathparamtemplatetype.md @@ -2,6 +2,14 @@ The type of template to toggle delivery for +## Example Usage + +```python +from clerk_backend_api.models import ToggleTemplateDeliveryPathParamTemplateType + +value = ToggleTemplateDeliveryPathParamTemplateType.EMAIL +``` + ## Values diff --git a/docs/models/tokenformat.md b/docs/models/tokenformat.md new file mode 100644 index 00000000..013b723c --- /dev/null +++ b/docs/models/tokenformat.md @@ -0,0 +1,17 @@ +# TokenFormat + +## Example Usage + +```python +from clerk_backend_api.models import TokenFormat + +value = TokenFormat.OPAQUE +``` + + +## Values + +| Name | Value | +| -------- | -------- | +| `OPAQUE` | opaque | +| `JWT` | jwt | \ No newline at end of file diff --git a/docs/models/tokenobject.md b/docs/models/tokenobject.md index 724c890d..82481f29 100644 --- a/docs/models/tokenobject.md +++ b/docs/models/tokenobject.md @@ -3,6 +3,14 @@ String representing the object's type. Objects of the same type share the same value. +## Example Usage + +```python +from clerk_backend_api.models import TokenObject + +value = TokenObject.TOKEN +``` + ## Values diff --git a/docs/models/totalcountobject.md b/docs/models/totalcountobject.md index 4781d70a..3c3848f7 100644 --- a/docs/models/totalcountobject.md +++ b/docs/models/totalcountobject.md @@ -3,6 +3,14 @@ String representing the object's type. Objects of the same type share the same value. +## Example Usage + +```python +from clerk_backend_api.models import TotalCountObject + +value = TotalCountObject.TOTAL_COUNT +``` + ## Values diff --git a/docs/models/totals.md b/docs/models/totals.md index a9b75ab8..7c94d87b 100644 --- a/docs/models/totals.md +++ b/docs/models/totals.md @@ -1,12 +1,15 @@ # Totals -Totals for the statement. +Totals for this subscription item. ## Fields -| Field | Type | Required | Description | -| ------------------------------------------------------------------ | ------------------------------------------------------------------ | ------------------------------------------------------------------ | ------------------------------------------------------------------ | -| `grand_total` | [models.CommerceMoneyResponse](../models/commercemoneyresponse.md) | :heavy_check_mark: | N/A | -| `subtotal` | [models.CommerceMoneyResponse](../models/commercemoneyresponse.md) | :heavy_check_mark: | N/A | -| `tax_total` | [models.CommerceMoneyResponse](../models/commercemoneyresponse.md) | :heavy_check_mark: | N/A | \ No newline at end of file +| Field | Type | Required | Description | +| -------------------------------------------------------------------------------------------------------- | -------------------------------------------------------------------------------------------------------- | -------------------------------------------------------------------------------------------------------- | -------------------------------------------------------------------------------------------------------- | +| `subtotal` | [models.CommerceMoneyResponse](../models/commercemoneyresponse.md) | :heavy_check_mark: | N/A | +| `base_fee` | [models.CommerceMoneyResponse](../models/commercemoneyresponse.md) | :heavy_check_mark: | N/A | +| `tax_total` | [models.CommerceMoneyResponse](../models/commercemoneyresponse.md) | :heavy_check_mark: | N/A | +| `grand_total` | [models.CommerceMoneyResponse](../models/commercemoneyresponse.md) | :heavy_check_mark: | N/A | +| `per_unit_totals` | List[[models.CommercePerUnitTotal](../models/commerceperunittotal.md)] | :heavy_minus_sign: | N/A | +| `credits` | [OptionalNullable[models.CommerceSubscriptionItemCredits]](../models/commercesubscriptionitemcredits.md) | :heavy_minus_sign: | N/A | \ No newline at end of file diff --git a/docs/models/type.md b/docs/models/type.md index 5e7aa828..d5d6e891 100644 --- a/docs/models/type.md +++ b/docs/models/type.md @@ -2,6 +2,14 @@ The type of the role set ("initial" or "custom") +## Example Usage + +```python +from clerk_backend_api.models import Type + +value = Type.INITIAL +``` + ## Values diff --git a/docs/models/updateapikeyobject.md b/docs/models/updateapikeyobject.md index 4bfe6132..f164a890 100644 --- a/docs/models/updateapikeyobject.md +++ b/docs/models/updateapikeyobject.md @@ -1,5 +1,13 @@ # UpdateAPIKeyObject +## Example Usage + +```python +from clerk_backend_api.models import UpdateAPIKeyObject + +value = UpdateAPIKeyObject.API_KEY +``` + ## Values diff --git a/docs/models/updateinstanceoauthapplicationsettingsrequestbody.md b/docs/models/updateinstanceoauthapplicationsettingsrequestbody.md new file mode 100644 index 00000000..bcf185cc --- /dev/null +++ b/docs/models/updateinstanceoauthapplicationsettingsrequestbody.md @@ -0,0 +1,9 @@ +# UpdateInstanceOAuthApplicationSettingsRequestBody + + +## Fields + +| Field | Type | Required | Description | +| ------------------------------------------------------------------------------------------------------- | ------------------------------------------------------------------------------------------------------- | ------------------------------------------------------------------------------------------------------- | ------------------------------------------------------------------------------------------------------- | +| `dynamic_oauth_client_registration` | *OptionalNullable[bool]* | :heavy_minus_sign: | Whether dynamic OAuth client registration is enabled for the instance (RFC 7591). | +| `oauth_jwt_access_tokens` | *OptionalNullable[bool]* | :heavy_minus_sign: | Whether OAuth JWT access tokens are enabled for the instance (disabled indicates opaque access tokens). | \ No newline at end of file diff --git a/docs/models/updaterolesettype.md b/docs/models/updaterolesettype.md index 773d4b6c..e662a7c2 100644 --- a/docs/models/updaterolesettype.md +++ b/docs/models/updaterolesettype.md @@ -3,6 +3,14 @@ Set to "initial" to make this the default role set for new organizations. Only one role set can be "initial" per instance; setting this will change any existing initial role set to "custom". +## Example Usage + +```python +from clerk_backend_api.models import UpdateRoleSetType + +value = UpdateRoleSetType.INITIAL +``` + ## Values diff --git a/docs/models/upserttemplatepathparamtemplatetype.md b/docs/models/upserttemplatepathparamtemplatetype.md index 347c2609..53fe9973 100644 --- a/docs/models/upserttemplatepathparamtemplatetype.md +++ b/docs/models/upserttemplatepathparamtemplatetype.md @@ -2,6 +2,14 @@ The type of template to update +## Example Usage + +```python +from clerk_backend_api.models import UpsertTemplatePathParamTemplateType + +value = UpsertTemplatePathParamTemplateType.EMAIL +``` + ## Values diff --git a/docs/models/userobject.md b/docs/models/userobject.md index 5ebea173..0e53566f 100644 --- a/docs/models/userobject.md +++ b/docs/models/userobject.md @@ -3,6 +3,14 @@ String representing the object's type. Objects of the same type share the same value. +## Example Usage + +```python +from clerk_backend_api.models import UserObject + +value = UserObject.USER +``` + ## Values diff --git a/docs/models/usersgetorganizationinvitationsqueryparamstatus.md b/docs/models/usersgetorganizationinvitationsqueryparamstatus.md index e59b4c39..91f75b22 100644 --- a/docs/models/usersgetorganizationinvitationsqueryparamstatus.md +++ b/docs/models/usersgetorganizationinvitationsqueryparamstatus.md @@ -2,6 +2,14 @@ Filter organization invitations based on their status +## Example Usage + +```python +from clerk_backend_api.models import UsersGetOrganizationInvitationsQueryParamStatus + +value = UsersGetOrganizationInvitationsQueryParamStatus.PENDING +``` + ## Values @@ -9,4 +17,5 @@ Filter organization invitations based on their status | ---------- | ---------- | | `PENDING` | pending | | `ACCEPTED` | accepted | -| `REVOKED` | revoked | \ No newline at end of file +| `REVOKED` | revoked | +| `EXPIRED` | expired | \ No newline at end of file diff --git a/docs/models/verificationadminverificationobject.md b/docs/models/verificationadminverificationobject.md index a2640269..1792a82a 100644 --- a/docs/models/verificationadminverificationobject.md +++ b/docs/models/verificationadminverificationobject.md @@ -1,5 +1,13 @@ # VerificationAdminVerificationObject +## Example Usage + +```python +from clerk_backend_api.models import VerificationAdminVerificationObject + +value = VerificationAdminVerificationObject.VERIFICATION_ADMIN +``` + ## Values diff --git a/docs/models/verificationadminverificationphonenumberobject.md b/docs/models/verificationadminverificationphonenumberobject.md index 89e30c11..15c697b8 100644 --- a/docs/models/verificationadminverificationphonenumberobject.md +++ b/docs/models/verificationadminverificationphonenumberobject.md @@ -1,5 +1,13 @@ # VerificationAdminVerificationPhoneNumberObject +## Example Usage + +```python +from clerk_backend_api.models import VerificationAdminVerificationPhoneNumberObject + +value = VerificationAdminVerificationPhoneNumberObject.VERIFICATION_ADMIN +``` + ## Values diff --git a/docs/models/verificationadminverificationphonenumberstatus.md b/docs/models/verificationadminverificationphonenumberstatus.md index 09318d51..832be595 100644 --- a/docs/models/verificationadminverificationphonenumberstatus.md +++ b/docs/models/verificationadminverificationphonenumberstatus.md @@ -1,5 +1,13 @@ # VerificationAdminVerificationPhoneNumberStatus +## Example Usage + +```python +from clerk_backend_api.models import VerificationAdminVerificationPhoneNumberStatus + +value = VerificationAdminVerificationPhoneNumberStatus.VERIFIED +``` + ## Values diff --git a/docs/models/verificationadminverificationstatus.md b/docs/models/verificationadminverificationstatus.md index 492e9e54..d931d3c3 100644 --- a/docs/models/verificationadminverificationstatus.md +++ b/docs/models/verificationadminverificationstatus.md @@ -1,5 +1,13 @@ # VerificationAdminVerificationStatus +## Example Usage + +```python +from clerk_backend_api.models import VerificationAdminVerificationStatus + +value = VerificationAdminVerificationStatus.VERIFIED +``` + ## Values diff --git a/docs/models/verificationadminverificationstrategy.md b/docs/models/verificationadminverificationstrategy.md index 0345d1ca..cc12e85f 100644 --- a/docs/models/verificationadminverificationstrategy.md +++ b/docs/models/verificationadminverificationstrategy.md @@ -1,5 +1,15 @@ # VerificationAdminVerificationStrategy +## Example Usage + +```python +from clerk_backend_api.models import VerificationAdminVerificationStrategy + +value = VerificationAdminVerificationStrategy.ADMIN + +# Open enum: unrecognized values are captured as UnrecognizedStr +``` + ## Values diff --git a/docs/models/verificationadminverificationweb3walletobject.md b/docs/models/verificationadminverificationweb3walletobject.md index a232c1c2..5256b87c 100644 --- a/docs/models/verificationadminverificationweb3walletobject.md +++ b/docs/models/verificationadminverificationweb3walletobject.md @@ -1,5 +1,13 @@ # VerificationAdminVerificationWeb3WalletObject +## Example Usage + +```python +from clerk_backend_api.models import VerificationAdminVerificationWeb3WalletObject + +value = VerificationAdminVerificationWeb3WalletObject.VERIFICATION_ADMIN +``` + ## Values diff --git a/docs/models/verificationadminverificationweb3walletstatus.md b/docs/models/verificationadminverificationweb3walletstatus.md index e0f8d8f7..e9c8bd00 100644 --- a/docs/models/verificationadminverificationweb3walletstatus.md +++ b/docs/models/verificationadminverificationweb3walletstatus.md @@ -1,5 +1,13 @@ # VerificationAdminVerificationWeb3WalletStatus +## Example Usage + +```python +from clerk_backend_api.models import VerificationAdminVerificationWeb3WalletStatus + +value = VerificationAdminVerificationWeb3WalletStatus.VERIFIED +``` + ## Values diff --git a/docs/models/verificationadminverificationweb3walletstrategy.md b/docs/models/verificationadminverificationweb3walletstrategy.md index d88ebe77..6675fafa 100644 --- a/docs/models/verificationadminverificationweb3walletstrategy.md +++ b/docs/models/verificationadminverificationweb3walletstrategy.md @@ -1,5 +1,15 @@ # VerificationAdminVerificationWeb3WalletStrategy +## Example Usage + +```python +from clerk_backend_api.models import VerificationAdminVerificationWeb3WalletStrategy + +value = VerificationAdminVerificationWeb3WalletStrategy.ADMIN + +# Open enum: unrecognized values are captured as UnrecognizedStr +``` + ## Values diff --git a/docs/models/verificationemaillinkverificationobject.md b/docs/models/verificationemaillinkverificationobject.md index 7267283e..44188c2c 100644 --- a/docs/models/verificationemaillinkverificationobject.md +++ b/docs/models/verificationemaillinkverificationobject.md @@ -1,5 +1,13 @@ # VerificationEmailLinkVerificationObject +## Example Usage + +```python +from clerk_backend_api.models import VerificationEmailLinkVerificationObject + +value = VerificationEmailLinkVerificationObject.VERIFICATION_EMAIL_LINK +``` + ## Values diff --git a/docs/models/verificationemaillinkverificationstatus.md b/docs/models/verificationemaillinkverificationstatus.md index 8d568203..d8d9876d 100644 --- a/docs/models/verificationemaillinkverificationstatus.md +++ b/docs/models/verificationemaillinkverificationstatus.md @@ -1,5 +1,13 @@ # VerificationEmailLinkVerificationStatus +## Example Usage + +```python +from clerk_backend_api.models import VerificationEmailLinkVerificationStatus + +value = VerificationEmailLinkVerificationStatus.UNVERIFIED +``` + ## Values diff --git a/docs/models/verificationemaillinkverificationstrategy.md b/docs/models/verificationemaillinkverificationstrategy.md index acee69d8..90046865 100644 --- a/docs/models/verificationemaillinkverificationstrategy.md +++ b/docs/models/verificationemaillinkverificationstrategy.md @@ -1,5 +1,13 @@ # VerificationEmailLinkVerificationStrategy +## Example Usage + +```python +from clerk_backend_api.models import VerificationEmailLinkVerificationStrategy + +value = VerificationEmailLinkVerificationStrategy.EMAIL_LINK +``` + ## Values diff --git a/docs/models/verificationfromoauthverificationobject.md b/docs/models/verificationfromoauthverificationobject.md index 7d9d4dfe..d48e5498 100644 --- a/docs/models/verificationfromoauthverificationobject.md +++ b/docs/models/verificationfromoauthverificationobject.md @@ -1,5 +1,13 @@ # VerificationFromOauthVerificationObject +## Example Usage + +```python +from clerk_backend_api.models import VerificationFromOauthVerificationObject + +value = VerificationFromOauthVerificationObject.VERIFICATION_FROM_OAUTH +``` + ## Values diff --git a/docs/models/verificationfromoauthverificationstatus.md b/docs/models/verificationfromoauthverificationstatus.md index 460b707c..8c5f1bb3 100644 --- a/docs/models/verificationfromoauthverificationstatus.md +++ b/docs/models/verificationfromoauthverificationstatus.md @@ -1,5 +1,13 @@ # VerificationFromOauthVerificationStatus +## Example Usage + +```python +from clerk_backend_api.models import VerificationFromOauthVerificationStatus + +value = VerificationFromOauthVerificationStatus.UNVERIFIED +``` + ## Values diff --git a/docs/models/verificationgoogleonetapverificationobject.md b/docs/models/verificationgoogleonetapverificationobject.md index 940ee524..fa037776 100644 --- a/docs/models/verificationgoogleonetapverificationobject.md +++ b/docs/models/verificationgoogleonetapverificationobject.md @@ -1,5 +1,13 @@ # VerificationGoogleOneTapVerificationObject +## Example Usage + +```python +from clerk_backend_api.models import VerificationGoogleOneTapVerificationObject + +value = VerificationGoogleOneTapVerificationObject.VERIFICATION_GOOGLE_ONE_TAP +``` + ## Values diff --git a/docs/models/verificationgoogleonetapverificationstatus.md b/docs/models/verificationgoogleonetapverificationstatus.md index 496402a3..0345ab6c 100644 --- a/docs/models/verificationgoogleonetapverificationstatus.md +++ b/docs/models/verificationgoogleonetapverificationstatus.md @@ -1,5 +1,13 @@ # VerificationGoogleOneTapVerificationStatus +## Example Usage + +```python +from clerk_backend_api.models import VerificationGoogleOneTapVerificationStatus + +value = VerificationGoogleOneTapVerificationStatus.UNVERIFIED +``` + ## Values diff --git a/docs/models/verificationgoogleonetapverificationstrategy.md b/docs/models/verificationgoogleonetapverificationstrategy.md index a29c99ba..bd042be8 100644 --- a/docs/models/verificationgoogleonetapverificationstrategy.md +++ b/docs/models/verificationgoogleonetapverificationstrategy.md @@ -1,5 +1,13 @@ # VerificationGoogleOneTapVerificationStrategy +## Example Usage + +```python +from clerk_backend_api.models import VerificationGoogleOneTapVerificationStrategy + +value = VerificationGoogleOneTapVerificationStrategy.GOOGLE_ONE_TAP +``` + ## Values diff --git a/docs/models/verificationoauthverificationenterpriseaccountobject.md b/docs/models/verificationoauthverificationenterpriseaccountobject.md index e25ace1b..0d711937 100644 --- a/docs/models/verificationoauthverificationenterpriseaccountobject.md +++ b/docs/models/verificationoauthverificationenterpriseaccountobject.md @@ -1,5 +1,13 @@ # VerificationOauthVerificationEnterpriseAccountObject +## Example Usage + +```python +from clerk_backend_api.models import VerificationOauthVerificationEnterpriseAccountObject + +value = VerificationOauthVerificationEnterpriseAccountObject.VERIFICATION_OAUTH +``` + ## Values diff --git a/docs/models/verificationoauthverificationenterpriseaccountstatus.md b/docs/models/verificationoauthverificationenterpriseaccountstatus.md index e6f4a7a1..88f027b7 100644 --- a/docs/models/verificationoauthverificationenterpriseaccountstatus.md +++ b/docs/models/verificationoauthverificationenterpriseaccountstatus.md @@ -1,5 +1,15 @@ # VerificationOauthVerificationEnterpriseAccountStatus +## Example Usage + +```python +from clerk_backend_api.models import VerificationOauthVerificationEnterpriseAccountStatus + +value = VerificationOauthVerificationEnterpriseAccountStatus.UNVERIFIED + +# Open enum: unrecognized values are captured as UnrecognizedStr +``` + ## Values diff --git a/docs/models/verificationoauthverificationobject.md b/docs/models/verificationoauthverificationobject.md index 00910eab..e8ffa2b3 100644 --- a/docs/models/verificationoauthverificationobject.md +++ b/docs/models/verificationoauthverificationobject.md @@ -1,5 +1,13 @@ # VerificationOauthVerificationObject +## Example Usage + +```python +from clerk_backend_api.models import VerificationOauthVerificationObject + +value = VerificationOauthVerificationObject.VERIFICATION_OAUTH +``` + ## Values diff --git a/docs/models/verificationoauthverificationstatus.md b/docs/models/verificationoauthverificationstatus.md index 20d77351..0f3286c7 100644 --- a/docs/models/verificationoauthverificationstatus.md +++ b/docs/models/verificationoauthverificationstatus.md @@ -1,5 +1,15 @@ # VerificationOauthVerificationStatus +## Example Usage + +```python +from clerk_backend_api.models import VerificationOauthVerificationStatus + +value = VerificationOauthVerificationStatus.UNVERIFIED + +# Open enum: unrecognized values are captured as UnrecognizedStr +``` + ## Values diff --git a/docs/models/verificationobject.md b/docs/models/verificationobject.md index 17343181..4bf8f26a 100644 --- a/docs/models/verificationobject.md +++ b/docs/models/verificationobject.md @@ -1,5 +1,13 @@ # VerificationObject +## Example Usage + +```python +from clerk_backend_api.models import VerificationObject + +value = VerificationObject.VERIFICATION_OTP +``` + ## Values diff --git a/docs/models/verificationotpverificationobject.md b/docs/models/verificationotpverificationobject.md index 111ddb19..0be73dee 100644 --- a/docs/models/verificationotpverificationobject.md +++ b/docs/models/verificationotpverificationobject.md @@ -1,5 +1,13 @@ # VerificationOtpVerificationObject +## Example Usage + +```python +from clerk_backend_api.models import VerificationOtpVerificationObject + +value = VerificationOtpVerificationObject.VERIFICATION_OTP +``` + ## Values diff --git a/docs/models/verificationotpverificationstatus.md b/docs/models/verificationotpverificationstatus.md index 4e667bf3..a022a345 100644 --- a/docs/models/verificationotpverificationstatus.md +++ b/docs/models/verificationotpverificationstatus.md @@ -1,5 +1,13 @@ # VerificationOtpVerificationStatus +## Example Usage + +```python +from clerk_backend_api.models import VerificationOtpVerificationStatus + +value = VerificationOtpVerificationStatus.UNVERIFIED +``` + ## Values diff --git a/docs/models/verificationotpverificationstrategy.md b/docs/models/verificationotpverificationstrategy.md index e89a021a..97abcecb 100644 --- a/docs/models/verificationotpverificationstrategy.md +++ b/docs/models/verificationotpverificationstrategy.md @@ -1,5 +1,15 @@ # VerificationOtpVerificationStrategy +## Example Usage + +```python +from clerk_backend_api.models import VerificationOtpVerificationStrategy + +value = VerificationOtpVerificationStrategy.PHONE_CODE + +# Open enum: unrecognized values are captured as UnrecognizedStr +``` + ## Values diff --git a/docs/models/verificationpasskeyverificationobject.md b/docs/models/verificationpasskeyverificationobject.md index 1426d616..af605caf 100644 --- a/docs/models/verificationpasskeyverificationobject.md +++ b/docs/models/verificationpasskeyverificationobject.md @@ -1,5 +1,13 @@ # VerificationPasskeyVerificationObject +## Example Usage + +```python +from clerk_backend_api.models import VerificationPasskeyVerificationObject + +value = VerificationPasskeyVerificationObject.VERIFICATION_PASSKEY +``` + ## Values diff --git a/docs/models/verificationpasskeyverificationstatus.md b/docs/models/verificationpasskeyverificationstatus.md index 873e24ae..79efaea2 100644 --- a/docs/models/verificationpasskeyverificationstatus.md +++ b/docs/models/verificationpasskeyverificationstatus.md @@ -1,5 +1,13 @@ # VerificationPasskeyVerificationStatus +## Example Usage + +```python +from clerk_backend_api.models import VerificationPasskeyVerificationStatus + +value = VerificationPasskeyVerificationStatus.VERIFIED +``` + ## Values diff --git a/docs/models/verificationpasskeyverificationstrategy.md b/docs/models/verificationpasskeyverificationstrategy.md index 3bd7d5de..96d46687 100644 --- a/docs/models/verificationpasskeyverificationstrategy.md +++ b/docs/models/verificationpasskeyverificationstrategy.md @@ -1,5 +1,13 @@ # VerificationPasskeyVerificationStrategy +## Example Usage + +```python +from clerk_backend_api.models import VerificationPasskeyVerificationStrategy + +value = VerificationPasskeyVerificationStrategy.PASSKEY +``` + ## Values diff --git a/docs/models/verificationsamlverificationenterpriseaccountobject.md b/docs/models/verificationsamlverificationenterpriseaccountobject.md index 91e4385a..d15664af 100644 --- a/docs/models/verificationsamlverificationenterpriseaccountobject.md +++ b/docs/models/verificationsamlverificationenterpriseaccountobject.md @@ -1,5 +1,13 @@ # VerificationSamlVerificationEnterpriseAccountObject +## Example Usage + +```python +from clerk_backend_api.models import VerificationSamlVerificationEnterpriseAccountObject + +value = VerificationSamlVerificationEnterpriseAccountObject.VERIFICATION_SAML +``` + ## Values diff --git a/docs/models/verificationsamlverificationenterpriseaccountstatus.md b/docs/models/verificationsamlverificationenterpriseaccountstatus.md index ff668f0d..077daccc 100644 --- a/docs/models/verificationsamlverificationenterpriseaccountstatus.md +++ b/docs/models/verificationsamlverificationenterpriseaccountstatus.md @@ -1,5 +1,13 @@ # VerificationSamlVerificationEnterpriseAccountStatus +## Example Usage + +```python +from clerk_backend_api.models import VerificationSamlVerificationEnterpriseAccountStatus + +value = VerificationSamlVerificationEnterpriseAccountStatus.UNVERIFIED +``` + ## Values diff --git a/docs/models/verificationsamlverificationenterpriseaccountstrategy.md b/docs/models/verificationsamlverificationenterpriseaccountstrategy.md index 6c97a442..601dd9b1 100644 --- a/docs/models/verificationsamlverificationenterpriseaccountstrategy.md +++ b/docs/models/verificationsamlverificationenterpriseaccountstrategy.md @@ -1,5 +1,13 @@ # VerificationSamlVerificationEnterpriseAccountStrategy +## Example Usage + +```python +from clerk_backend_api.models import VerificationSamlVerificationEnterpriseAccountStrategy + +value = VerificationSamlVerificationEnterpriseAccountStrategy.SAML +``` + ## Values diff --git a/docs/models/verificationsamlverificationobject.md b/docs/models/verificationsamlverificationobject.md index 0675d7b0..05dbcc6d 100644 --- a/docs/models/verificationsamlverificationobject.md +++ b/docs/models/verificationsamlverificationobject.md @@ -1,5 +1,13 @@ # VerificationSamlVerificationObject +## Example Usage + +```python +from clerk_backend_api.models import VerificationSamlVerificationObject + +value = VerificationSamlVerificationObject.VERIFICATION_SAML +``` + ## Values diff --git a/docs/models/verificationsamlverificationsamlaccountobject.md b/docs/models/verificationsamlverificationsamlaccountobject.md index 79a9ebfd..55ab04b0 100644 --- a/docs/models/verificationsamlverificationsamlaccountobject.md +++ b/docs/models/verificationsamlverificationsamlaccountobject.md @@ -1,5 +1,13 @@ # VerificationSAMLVerificationSAMLAccountObject +## Example Usage + +```python +from clerk_backend_api.models import VerificationSAMLVerificationSAMLAccountObject + +value = VerificationSAMLVerificationSAMLAccountObject.VERIFICATION_SAML +``` + ## Values diff --git a/docs/models/verificationsamlverificationsamlaccountstatus.md b/docs/models/verificationsamlverificationsamlaccountstatus.md index 645ee851..c228919b 100644 --- a/docs/models/verificationsamlverificationsamlaccountstatus.md +++ b/docs/models/verificationsamlverificationsamlaccountstatus.md @@ -1,5 +1,13 @@ # VerificationSAMLVerificationSAMLAccountStatus +## Example Usage + +```python +from clerk_backend_api.models import VerificationSAMLVerificationSAMLAccountStatus + +value = VerificationSAMLVerificationSAMLAccountStatus.UNVERIFIED +``` + ## Values diff --git a/docs/models/verificationsamlverificationsamlaccountstrategy.md b/docs/models/verificationsamlverificationsamlaccountstrategy.md index 4aa285a1..dfc35790 100644 --- a/docs/models/verificationsamlverificationsamlaccountstrategy.md +++ b/docs/models/verificationsamlverificationsamlaccountstrategy.md @@ -1,5 +1,13 @@ # VerificationSAMLVerificationSAMLAccountStrategy +## Example Usage + +```python +from clerk_backend_api.models import VerificationSAMLVerificationSAMLAccountStrategy + +value = VerificationSAMLVerificationSAMLAccountStrategy.SAML +``` + ## Values diff --git a/docs/models/verificationsamlverificationstatus.md b/docs/models/verificationsamlverificationstatus.md index af316008..4afe3ea3 100644 --- a/docs/models/verificationsamlverificationstatus.md +++ b/docs/models/verificationsamlverificationstatus.md @@ -1,5 +1,13 @@ # VerificationSamlVerificationStatus +## Example Usage + +```python +from clerk_backend_api.models import VerificationSamlVerificationStatus + +value = VerificationSamlVerificationStatus.UNVERIFIED +``` + ## Values diff --git a/docs/models/verificationsamlverificationstrategy.md b/docs/models/verificationsamlverificationstrategy.md index 990f20fb..45ab6a8b 100644 --- a/docs/models/verificationsamlverificationstrategy.md +++ b/docs/models/verificationsamlverificationstrategy.md @@ -1,5 +1,13 @@ # VerificationSamlVerificationStrategy +## Example Usage + +```python +from clerk_backend_api.models import VerificationSamlVerificationStrategy + +value = VerificationSamlVerificationStrategy.SAML +``` + ## Values diff --git a/docs/models/verificationstatus.md b/docs/models/verificationstatus.md index 7da7c68a..c7cefe35 100644 --- a/docs/models/verificationstatus.md +++ b/docs/models/verificationstatus.md @@ -1,5 +1,13 @@ # VerificationStatus +## Example Usage + +```python +from clerk_backend_api.models import VerificationStatus + +value = VerificationStatus.UNVERIFIED +``` + ## Values diff --git a/docs/models/verificationstrategy.md b/docs/models/verificationstrategy.md index 4cc127f7..fe19a684 100644 --- a/docs/models/verificationstrategy.md +++ b/docs/models/verificationstrategy.md @@ -1,5 +1,15 @@ # VerificationStrategy +## Example Usage + +```python +from clerk_backend_api.models import VerificationStrategy + +value = VerificationStrategy.ADMIN + +# Open enum: unrecognized values are captured as UnrecognizedStr +``` + ## Values diff --git a/docs/models/verificationticketverificationenterpriseaccountobject.md b/docs/models/verificationticketverificationenterpriseaccountobject.md index c110276f..837647f3 100644 --- a/docs/models/verificationticketverificationenterpriseaccountobject.md +++ b/docs/models/verificationticketverificationenterpriseaccountobject.md @@ -1,5 +1,13 @@ # VerificationTicketVerificationEnterpriseAccountObject +## Example Usage + +```python +from clerk_backend_api.models import VerificationTicketVerificationEnterpriseAccountObject + +value = VerificationTicketVerificationEnterpriseAccountObject.VERIFICATION_TICKET +``` + ## Values diff --git a/docs/models/verificationticketverificationenterpriseaccountstatus.md b/docs/models/verificationticketverificationenterpriseaccountstatus.md index f3bb0a4e..8ac07ac8 100644 --- a/docs/models/verificationticketverificationenterpriseaccountstatus.md +++ b/docs/models/verificationticketverificationenterpriseaccountstatus.md @@ -1,5 +1,13 @@ # VerificationTicketVerificationEnterpriseAccountStatus +## Example Usage + +```python +from clerk_backend_api.models import VerificationTicketVerificationEnterpriseAccountStatus + +value = VerificationTicketVerificationEnterpriseAccountStatus.UNVERIFIED +``` + ## Values diff --git a/docs/models/verificationticketverificationenterpriseaccountstrategy.md b/docs/models/verificationticketverificationenterpriseaccountstrategy.md index 6c7faca7..4f42dd48 100644 --- a/docs/models/verificationticketverificationenterpriseaccountstrategy.md +++ b/docs/models/verificationticketverificationenterpriseaccountstrategy.md @@ -1,5 +1,15 @@ # VerificationTicketVerificationEnterpriseAccountStrategy +## Example Usage + +```python +from clerk_backend_api.models import VerificationTicketVerificationEnterpriseAccountStrategy + +value = VerificationTicketVerificationEnterpriseAccountStrategy.TICKET + +# Open enum: unrecognized values are captured as UnrecognizedStr +``` + ## Values diff --git a/docs/models/verificationticketverificationobject.md b/docs/models/verificationticketverificationobject.md index 915cac66..f03c85c7 100644 --- a/docs/models/verificationticketverificationobject.md +++ b/docs/models/verificationticketverificationobject.md @@ -1,5 +1,13 @@ # VerificationTicketVerificationObject +## Example Usage + +```python +from clerk_backend_api.models import VerificationTicketVerificationObject + +value = VerificationTicketVerificationObject.VERIFICATION_TICKET +``` + ## Values diff --git a/docs/models/verificationticketverificationsamlaccountobject.md b/docs/models/verificationticketverificationsamlaccountobject.md index 532ca563..39b03df3 100644 --- a/docs/models/verificationticketverificationsamlaccountobject.md +++ b/docs/models/verificationticketverificationsamlaccountobject.md @@ -1,5 +1,13 @@ # VerificationTicketVerificationSAMLAccountObject +## Example Usage + +```python +from clerk_backend_api.models import VerificationTicketVerificationSAMLAccountObject + +value = VerificationTicketVerificationSAMLAccountObject.VERIFICATION_TICKET +``` + ## Values diff --git a/docs/models/verificationticketverificationsamlaccountstatus.md b/docs/models/verificationticketverificationsamlaccountstatus.md index f956f554..f87aa0ad 100644 --- a/docs/models/verificationticketverificationsamlaccountstatus.md +++ b/docs/models/verificationticketverificationsamlaccountstatus.md @@ -1,5 +1,13 @@ # VerificationTicketVerificationSAMLAccountStatus +## Example Usage + +```python +from clerk_backend_api.models import VerificationTicketVerificationSAMLAccountStatus + +value = VerificationTicketVerificationSAMLAccountStatus.UNVERIFIED +``` + ## Values diff --git a/docs/models/verificationticketverificationsamlaccountstrategy.md b/docs/models/verificationticketverificationsamlaccountstrategy.md index d5b0d34d..debabfc1 100644 --- a/docs/models/verificationticketverificationsamlaccountstrategy.md +++ b/docs/models/verificationticketverificationsamlaccountstrategy.md @@ -1,5 +1,15 @@ # VerificationTicketVerificationSAMLAccountStrategy +## Example Usage + +```python +from clerk_backend_api.models import VerificationTicketVerificationSAMLAccountStrategy + +value = VerificationTicketVerificationSAMLAccountStrategy.TICKET + +# Open enum: unrecognized values are captured as UnrecognizedStr +``` + ## Values diff --git a/docs/models/verificationticketverificationstatus.md b/docs/models/verificationticketverificationstatus.md index 28ee3fc4..34dc6be5 100644 --- a/docs/models/verificationticketverificationstatus.md +++ b/docs/models/verificationticketverificationstatus.md @@ -1,5 +1,13 @@ # VerificationTicketVerificationStatus +## Example Usage + +```python +from clerk_backend_api.models import VerificationTicketVerificationStatus + +value = VerificationTicketVerificationStatus.UNVERIFIED +``` + ## Values diff --git a/docs/models/verificationticketverificationstrategy.md b/docs/models/verificationticketverificationstrategy.md index d60e974f..0abc88f6 100644 --- a/docs/models/verificationticketverificationstrategy.md +++ b/docs/models/verificationticketverificationstrategy.md @@ -1,5 +1,15 @@ # VerificationTicketVerificationStrategy +## Example Usage + +```python +from clerk_backend_api.models import VerificationTicketVerificationStrategy + +value = VerificationTicketVerificationStrategy.TICKET + +# Open enum: unrecognized values are captured as UnrecognizedStr +``` + ## Values diff --git a/docs/models/verificationweb3verificationobject.md b/docs/models/verificationweb3verificationobject.md index 9a695cd4..2d580512 100644 --- a/docs/models/verificationweb3verificationobject.md +++ b/docs/models/verificationweb3verificationobject.md @@ -1,5 +1,13 @@ # VerificationWeb3VerificationObject +## Example Usage + +```python +from clerk_backend_api.models import VerificationWeb3VerificationObject + +value = VerificationWeb3VerificationObject.VERIFICATION_WEB3 +``` + ## Values diff --git a/docs/models/verificationweb3verificationstatus.md b/docs/models/verificationweb3verificationstatus.md index c4e551ed..89053c0a 100644 --- a/docs/models/verificationweb3verificationstatus.md +++ b/docs/models/verificationweb3verificationstatus.md @@ -1,5 +1,13 @@ # VerificationWeb3VerificationStatus +## Example Usage + +```python +from clerk_backend_api.models import VerificationWeb3VerificationStatus + +value = VerificationWeb3VerificationStatus.UNVERIFIED +``` + ## Values diff --git a/docs/models/verificationweb3verificationstrategy.md b/docs/models/verificationweb3verificationstrategy.md index cee04885..a0bedf78 100644 --- a/docs/models/verificationweb3verificationstrategy.md +++ b/docs/models/verificationweb3verificationstrategy.md @@ -1,5 +1,13 @@ # VerificationWeb3VerificationStrategy +## Example Usage + +```python +from clerk_backend_api.models import VerificationWeb3VerificationStrategy + +value = VerificationWeb3VerificationStrategy.WEB3_METAMASK_SIGNATURE +``` + ## Values diff --git a/docs/models/verified.md b/docs/models/verified.md index 0297cdff..a710da4c 100644 --- a/docs/models/verified.md +++ b/docs/models/verified.md @@ -2,6 +2,14 @@ Filter by verification status +## Example Usage + +```python +from clerk_backend_api.models import Verified + +value = Verified.TRUE +``` + ## Values diff --git a/docs/models/verifyapikeyobject.md b/docs/models/verifyapikeyobject.md index 8e332a6a..30dbdb4d 100644 --- a/docs/models/verifyapikeyobject.md +++ b/docs/models/verifyapikeyobject.md @@ -1,5 +1,13 @@ # VerifyAPIKeyObject +## Example Usage + +```python +from clerk_backend_api.models import VerifyAPIKeyObject + +value = VerifyAPIKeyObject.API_KEY +``` + ## Values diff --git a/docs/models/verifym2mtokenobject.md b/docs/models/verifym2mtokenobject.md index 89c81a3f..d57045e7 100644 --- a/docs/models/verifym2mtokenobject.md +++ b/docs/models/verifym2mtokenobject.md @@ -1,5 +1,13 @@ # VerifyM2MTokenObject +## Example Usage + +```python +from clerk_backend_api.models import VerifyM2MTokenObject + +value = VerifyM2MTokenObject.MACHINE_TO_MACHINE_TOKEN +``` + ## Values diff --git a/docs/models/waitlistentryinvitationobject.md b/docs/models/waitlistentryinvitationobject.md index 10427b5f..4a9b707f 100644 --- a/docs/models/waitlistentryinvitationobject.md +++ b/docs/models/waitlistentryinvitationobject.md @@ -1,5 +1,13 @@ # WaitlistEntryInvitationObject +## Example Usage + +```python +from clerk_backend_api.models import WaitlistEntryInvitationObject + +value = WaitlistEntryInvitationObject.INVITATION +``` + ## Values diff --git a/docs/models/waitlistentryinvitationstatus.md b/docs/models/waitlistentryinvitationstatus.md index 4e0aa7f6..595dbd8a 100644 --- a/docs/models/waitlistentryinvitationstatus.md +++ b/docs/models/waitlistentryinvitationstatus.md @@ -1,5 +1,13 @@ # WaitlistEntryInvitationStatus +## Example Usage + +```python +from clerk_backend_api.models import WaitlistEntryInvitationStatus + +value = WaitlistEntryInvitationStatus.PENDING +``` + ## Values diff --git a/docs/models/waitlistentryobject.md b/docs/models/waitlistentryobject.md index 33429077..f6ef0698 100644 --- a/docs/models/waitlistentryobject.md +++ b/docs/models/waitlistentryobject.md @@ -1,5 +1,13 @@ # WaitlistEntryObject +## Example Usage + +```python +from clerk_backend_api.models import WaitlistEntryObject + +value = WaitlistEntryObject.WAITLIST_ENTRY +``` + ## Values diff --git a/docs/models/waitlistentrystatus.md b/docs/models/waitlistentrystatus.md index 65b1c1db..cb55428c 100644 --- a/docs/models/waitlistentrystatus.md +++ b/docs/models/waitlistentrystatus.md @@ -1,5 +1,13 @@ # WaitlistEntryStatus +## Example Usage + +```python +from clerk_backend_api.models import WaitlistEntryStatus + +value = WaitlistEntryStatus.PENDING +``` + ## Values diff --git a/docs/models/web3walletobject.md b/docs/models/web3walletobject.md index e5f74581..5357c560 100644 --- a/docs/models/web3walletobject.md +++ b/docs/models/web3walletobject.md @@ -3,6 +3,14 @@ String representing the object's type. Objects of the same type share the same value. +## Example Usage + +```python +from clerk_backend_api.models import Web3WalletObject + +value = Web3WalletObject.WEB3_WALLET +``` + ## Values diff --git a/docs/sdks/agenttasks/README.md b/docs/sdks/agenttasks/README.md new file mode 100644 index 00000000..f82d65de --- /dev/null +++ b/docs/sdks/agenttasks/README.md @@ -0,0 +1,100 @@ +# AgentTasks + +## Overview + +### Available Operations + +* [create](#create) - Create agent task +* [revoke](#revoke) - Revoke agent task + +## create + +Create an agent task on behalf of a user. +The response contains a URL that, when visited, creates a session for the user. +The agent_id is stable per agent_name within an instance. The task_id is unique per call. + +### Example Usage + + +```python +import clerk_backend_api +from clerk_backend_api import Clerk + + +with Clerk( + bearer_auth="", +) as clerk: + + res = clerk.agent_tasks.create(request={ + "on_behalf_of": { + "user_id": "", + "identifier": "", + }, + "permissions": clerk_backend_api.CreateAgentTaskPermissions.WILDCARD_, + "agent_name": "", + "task_description": "", + "redirect_url": "https://brilliant-typewriter.net", + }) + + # Handle response + print(res) + +``` + +### Parameters + +| Parameter | Type | Required | Description | +| ------------------------------------------------------------------------------- | ------------------------------------------------------------------------------- | ------------------------------------------------------------------------------- | ------------------------------------------------------------------------------- | +| `request` | [models.CreateAgentTaskRequestBody](../../models/createagenttaskrequestbody.md) | :heavy_check_mark: | The request object to use for the request. | +| `retries` | [Optional[utils.RetryConfig]](../../models/utils/retryconfig.md) | :heavy_minus_sign: | Configuration to override the default retry behavior of the client. | + +### Response + +**[models.AgentTask](../../models/agenttask.md)** + +### Errors + +| Error Type | Status Code | Content Type | +| ------------------ | ------------------ | ------------------ | +| models.ClerkErrors | 400, 404, 422 | application/json | +| models.SDKError | 4XX, 5XX | \*/\* | + +## revoke + +Revokes a pending agent task. + +### Example Usage + + +```python +from clerk_backend_api import Clerk + + +with Clerk( + bearer_auth="", +) as clerk: + + res = clerk.agent_tasks.revoke(agent_task_id="") + + # Handle response + print(res) + +``` + +### Parameters + +| Parameter | Type | Required | Description | +| ------------------------------------------------------------------- | ------------------------------------------------------------------- | ------------------------------------------------------------------- | ------------------------------------------------------------------- | +| `agent_task_id` | *str* | :heavy_check_mark: | The ID of the agent task to be revoked. | +| `retries` | [Optional[utils.RetryConfig]](../../models/utils/retryconfig.md) | :heavy_minus_sign: | Configuration to override the default retry behavior of the client. | + +### Response + +**[models.AgentTask](../../models/agenttask.md)** + +### Errors + +| Error Type | Status Code | Content Type | +| ------------------ | ------------------ | ------------------ | +| models.ClerkErrors | 400, 404 | application/json | +| models.SDKError | 4XX, 5XX | \*/\* | \ No newline at end of file diff --git a/docs/sdks/emailaddresses/README.md b/docs/sdks/emailaddresses/README.md index 5179c8c1..586ce69d 100644 --- a/docs/sdks/emailaddresses/README.md +++ b/docs/sdks/emailaddresses/README.md @@ -49,10 +49,10 @@ with Clerk( ### Errors -| Error Type | Status Code | Content Type | -| ----------------------- | ----------------------- | ----------------------- | -| models.ClerkErrors | 400, 401, 403, 404, 422 | application/json | -| models.SDKError | 4XX, 5XX | \*/\* | +| Error Type | Status Code | Content Type | +| ---------------------------- | ---------------------------- | ---------------------------- | +| models.ClerkErrors | 400, 401, 403, 404, 409, 422 | application/json | +| models.SDKError | 4XX, 5XX | \*/\* | ## get @@ -171,7 +171,7 @@ with Clerk( ### Errors -| Error Type | Status Code | Content Type | -| ------------------ | ------------------ | ------------------ | -| models.ClerkErrors | 400, 401, 403, 404 | application/json | -| models.SDKError | 4XX, 5XX | \*/\* | \ No newline at end of file +| Error Type | Status Code | Content Type | +| ----------------------- | ----------------------- | ----------------------- | +| models.ClerkErrors | 400, 401, 403, 404, 409 | application/json | +| models.SDKError | 4XX, 5XX | \*/\* | \ No newline at end of file diff --git a/docs/sdks/instancesettingssdk/README.md b/docs/sdks/instancesettingssdk/README.md index aa2a0d04..851af123 100644 --- a/docs/sdks/instancesettingssdk/README.md +++ b/docs/sdks/instancesettingssdk/README.md @@ -9,6 +9,8 @@ Modify the settings of your instance. * [get](#get) - Fetch the current instance * [update](#update) - Update instance settings * [update_restrictions](#update_restrictions) - Update instance restrictions +* [get_o_auth_application_settings](#get_o_auth_application_settings) - Get OAuth application settings +* [update_o_auth_application_settings](#update_o_auth_application_settings) - Update OAuth application settings * [change_domain](#change_domain) - Update production instance domain * [update_organization_settings](#update_organization_settings) - Update instance organization settings * [get_instance_protect](#get_instance_protect) - Get instance protect settings @@ -145,6 +147,87 @@ with Clerk( | models.ClerkErrors | 402, 422 | application/json | | models.SDKError | 4XX, 5XX | \*/\* | +## get_o_auth_application_settings + +Retrieves the settings for OAuth applications for the instance (dynamic client registration, JWT access tokens, etc.). + +### Example Usage + + +```python +from clerk_backend_api import Clerk + + +with Clerk( + bearer_auth="", +) as clerk: + + res = clerk.instance_settings.get_o_auth_application_settings() + + # Handle response + print(res) + +``` + +### Parameters + +| Parameter | Type | Required | Description | +| ------------------------------------------------------------------- | ------------------------------------------------------------------- | ------------------------------------------------------------------- | ------------------------------------------------------------------- | +| `retries` | [Optional[utils.RetryConfig]](../../models/utils/retryconfig.md) | :heavy_minus_sign: | Configuration to override the default retry behavior of the client. | + +### Response + +**[models.OAuthApplicationSettings](../../models/oauthapplicationsettings.md)** + +### Errors + +| Error Type | Status Code | Content Type | +| --------------- | --------------- | --------------- | +| models.SDKError | 4XX, 5XX | \*/\* | + +## update_o_auth_application_settings + +Updates the OAuth application settings for the instance. + +### Example Usage + + +```python +from clerk_backend_api import Clerk + + +with Clerk( + bearer_auth="", +) as clerk: + + res = clerk.instance_settings.update_o_auth_application_settings(request={ + "dynamic_oauth_client_registration": False, + "oauth_jwt_access_tokens": True, + }) + + # Handle response + print(res) + +``` + +### Parameters + +| Parameter | Type | Required | Description | +| ----------------------------------------------------------------------------------------------------------------------------- | ----------------------------------------------------------------------------------------------------------------------------- | ----------------------------------------------------------------------------------------------------------------------------- | ----------------------------------------------------------------------------------------------------------------------------- | +| `request` | [models.UpdateInstanceOAuthApplicationSettingsRequestBody](../../models/updateinstanceoauthapplicationsettingsrequestbody.md) | :heavy_check_mark: | The request object to use for the request. | +| `retries` | [Optional[utils.RetryConfig]](../../models/utils/retryconfig.md) | :heavy_minus_sign: | Configuration to override the default retry behavior of the client. | + +### Response + +**[models.OAuthApplicationSettings](../../models/oauthapplicationsettings.md)** + +### Errors + +| Error Type | Status Code | Content Type | +| ------------------ | ------------------ | ------------------ | +| models.ClerkErrors | 422 | application/json | +| models.SDKError | 4XX, 5XX | \*/\* | + ## change_domain Change the domain of a production instance. diff --git a/docs/sdks/m2m/README.md b/docs/sdks/m2m/README.md index 5c15a18a..728b2c3f 100644 --- a/docs/sdks/m2m/README.md +++ b/docs/sdks/m2m/README.md @@ -17,6 +17,7 @@ Creates a new M2M Token. Must be authenticated via a Machine Secret Key. ```python +import clerk_backend_api from clerk_backend_api import Clerk @@ -24,7 +25,7 @@ with Clerk( bearer_auth="", ) as clerk: - res = clerk.m2m.create_token(seconds_until_expiration=9240.85, claims="") + res = clerk.m2m.create_token(token_format=clerk_backend_api.TokenFormat.OPAQUE, seconds_until_expiration=9240.85, claims="") # Handle response print(res) @@ -35,6 +36,7 @@ with Clerk( | Parameter | Type | Required | Description | | ------------------------------------------------------------------- | ------------------------------------------------------------------- | ------------------------------------------------------------------- | ------------------------------------------------------------------- | +| `token_format` | [Optional[models.TokenFormat]](../../models/tokenformat.md) | :heavy_minus_sign: | N/A | | `seconds_until_expiration` | *OptionalNullable[float]* | :heavy_minus_sign: | N/A | | `claims` | *OptionalNullable[Any]* | :heavy_minus_sign: | N/A | | `retries` | [Optional[utils.RetryConfig]](../../models/utils/retryconfig.md) | :heavy_minus_sign: | Configuration to override the default retry behavior of the client. | @@ -55,6 +57,8 @@ with Clerk( Fetches M2M tokens for a specific machine. +Only tokens created with the opaque token format are returned by this endpoint. JWT-format M2M tokens are stateless and are not stored. + This endpoint can be authenticated by either a Machine Secret Key or by a Clerk Secret Key. - When fetching M2M tokens with a Machine Secret Key, only tokens associated with the authenticated machine can be retrieved. @@ -106,6 +110,8 @@ with Clerk( Revokes a M2M Token. +This endpoint only revokes stored opaque-format M2M tokens. JWT-format M2M tokens are stateless and cannot be revoked. + This endpoint can be authenticated by either a Machine Secret Key or by a Clerk Secret Key. - When revoking a M2M Token with a Machine Secret Key, the token must managed by the Machine associated with the Machine Secret Key. diff --git a/docs/sdks/organizationinvitationssdk/README.md b/docs/sdks/organizationinvitationssdk/README.md index 5cd0f742..d28f8db4 100644 --- a/docs/sdks/organizationinvitationssdk/README.md +++ b/docs/sdks/organizationinvitationssdk/README.md @@ -125,10 +125,10 @@ with Clerk( ### Errors -| Error Type | Status Code | Content Type | -| ------------------ | ------------------ | ------------------ | -| models.ClerkErrors | 400, 403, 404, 422 | application/json | -| models.SDKError | 4XX, 5XX | \*/\* | +| Error Type | Status Code | Content Type | +| ----------------------- | ----------------------- | ----------------------- | +| models.ClerkErrors | 400, 402, 403, 404, 422 | application/json | +| models.SDKError | 4XX, 5XX | \*/\* | ## list diff --git a/docs/sdks/organizationssdk/README.md b/docs/sdks/organizationssdk/README.md index 1c44d731..1413d759 100644 --- a/docs/sdks/organizationssdk/README.md +++ b/docs/sdks/organizationssdk/README.md @@ -13,6 +13,8 @@ * [upload_logo](#upload_logo) - Upload a logo for the organization * [delete_logo](#delete_logo) - Delete the organization's logo. * [get_billing_subscription](#get_billing_subscription) - Retrieve an organization's billing subscription +* [get_billing_credit_balance](#get_billing_credit_balance) - Retrieve an organization's credit balance +* [adjust_billing_credit_balance](#adjust_billing_credit_balance) - Adjust an organization's credit balance ## list @@ -219,10 +221,10 @@ with Clerk( ### Errors -| Error Type | Status Code | Content Type | -| ------------------ | ------------------ | ------------------ | -| models.ClerkErrors | 402, 403, 404, 422 | application/json | -| models.SDKError | 4XX, 5XX | \*/\* | +| Error Type | Status Code | Content Type | +| ----------------------- | ----------------------- | ----------------------- | +| models.ClerkErrors | 400, 402, 403, 404, 422 | application/json | +| models.SDKError | 4XX, 5XX | \*/\* | ## delete @@ -447,4 +449,95 @@ with Clerk( | ----------------------- | ----------------------- | ----------------------- | | models.ClerkErrors | 400, 401, 403, 404, 422 | application/json | | models.ClerkErrors | 500 | application/json | -| models.SDKError | 4XX, 5XX | \*/\* | \ No newline at end of file +| models.SDKError | 4XX, 5XX | \*/\* | + +## get_billing_credit_balance + +Retrieves the current credit balance for the specified organization. +Credits can be applied during checkout to reduce the charge or automatically applied to upcoming recurring charges. + +### Example Usage + + +```python +from clerk_backend_api import Clerk + + +with Clerk( + bearer_auth="", +) as clerk: + + res = clerk.organizations.get_billing_credit_balance(organization_id="") + + # Handle response + print(res) + +``` + +### Parameters + +| Parameter | Type | Required | Description | +| ------------------------------------------------------------------- | ------------------------------------------------------------------- | ------------------------------------------------------------------- | ------------------------------------------------------------------- | +| `organization_id` | *str* | :heavy_check_mark: | The ID of the organization whose credit balance to retrieve | +| `retries` | [Optional[utils.RetryConfig]](../../models/utils/retryconfig.md) | :heavy_minus_sign: | Configuration to override the default retry behavior of the client. | + +### Response + +**[models.CommerceCreditBalanceResponse](../../models/commercecreditbalanceresponse.md)** + +### Errors + +| Error Type | Status Code | Content Type | +| ----------------------- | ----------------------- | ----------------------- | +| models.ClerkErrors | 400, 401, 403, 404, 422 | application/json | +| models.ClerkErrors | 500 | application/json | +| models.SDKError | 4XX, 5XX | \*/\* | + +## adjust_billing_credit_balance + +Increases or decreases the credit balance for the specified organization. +Each adjustment is recorded as a ledger entry. The idempotency_key parameter +ensures that duplicate requests are safely handled. + +### Example Usage + + +```python +import clerk_backend_api +from clerk_backend_api import Clerk + + +with Clerk( + bearer_auth="", +) as clerk: + + res = clerk.organizations.adjust_billing_credit_balance(organization_id="", amount=245081, action=clerk_backend_api.Action.INCREASE, idempotency_key="", currency="Seychelles Rupee", note="") + + # Handle response + print(res) + +``` + +### Parameters + +| Parameter | Type | Required | Description | +| --------------------------------------------------------------------------------------------------------------------------------- | --------------------------------------------------------------------------------------------------------------------------------- | --------------------------------------------------------------------------------------------------------------------------------- | --------------------------------------------------------------------------------------------------------------------------------- | +| `organization_id` | *str* | :heavy_check_mark: | The ID of the organization whose credit balance to adjust | +| `amount` | *int* | :heavy_check_mark: | The credit amount in cents. Must be greater than zero. | +| `action` | [models.Action](../../models/action.md) | :heavy_check_mark: | Whether to increase or decrease the credit balance. | +| `idempotency_key` | *str* | :heavy_check_mark: | A unique key to ensure the adjustment is applied only once. Repeated requests with the same key return the original ledger entry. | +| `currency` | *Optional[str]* | :heavy_minus_sign: | The currency code (e.g. "USD"). Defaults to USD if not provided. | +| `note` | *Optional[str]* | :heavy_minus_sign: | An optional note to attach to the ledger entry. | +| `retries` | [Optional[utils.RetryConfig]](../../models/utils/retryconfig.md) | :heavy_minus_sign: | Configuration to override the default retry behavior of the client. | + +### Response + +**[models.CommerceCreditLedgerResponse](../../models/commercecreditledgerresponse.md)** + +### Errors + +| Error Type | Status Code | Content Type | +| ---------------------------- | ---------------------------- | ---------------------------- | +| models.ClerkErrors | 400, 401, 403, 404, 409, 422 | application/json | +| models.ClerkErrors | 500 | application/json | +| models.SDKError | 4XX, 5XX | \*/\* | \ No newline at end of file diff --git a/docs/sdks/sessions/README.md b/docs/sdks/sessions/README.md index 5c6e5595..ce0066d2 100644 --- a/docs/sdks/sessions/README.md +++ b/docs/sdks/sessions/README.md @@ -14,8 +14,11 @@ ## list -Returns a list of all sessions. +Returns a list of sessions matching the provided criteria. The sessions are returned sorted by creation date, with the newest sessions appearing first. + +Note: This endpoint does not return all sessions that have ever existed. Old and inactive sessions are periodically cleaned up and will not be included in the results. + **Deprecation Notice (2024-01-01):** All parameters were initially considered optional, however moving forward at least one of `client_id` or `user_id` parameters should be provided. diff --git a/docs/sdks/users/README.md b/docs/sdks/users/README.md index bb94c38f..22d69951 100644 --- a/docs/sdks/users/README.md +++ b/docs/sdks/users/README.md @@ -20,6 +20,8 @@ * [delete_profile_image](#delete_profile_image) - Delete user profile image * [update_metadata](#update_metadata) - Merge and update a user's metadata * [get_billing_subscription](#get_billing_subscription) - Retrieve a user's billing subscription +* [get_billing_credit_balance](#get_billing_credit_balance) - Retrieve a user's credit balance +* [adjust_billing_credit_balance](#adjust_billing_credit_balance) - Adjust a user's credit balance * [get_o_auth_access_token](#get_o_auth_access_token) - Retrieve the OAuth access token of a user * [get_organization_memberships](#get_organization_memberships) - Retrieve all memberships for a user * [get_organization_invitations](#get_organization_invitations) - Retrieve all invitations for a user @@ -407,10 +409,10 @@ with Clerk( ### Errors -| Error Type | Status Code | Content Type | -| ------------------ | ------------------ | ------------------ | -| models.ClerkErrors | 400, 401, 404, 422 | application/json | -| models.SDKError | 4XX, 5XX | \*/\* | +| Error Type | Status Code | Content Type | +| ----------------------- | ----------------------- | ----------------------- | +| models.ClerkErrors | 400, 401, 404, 409, 422 | application/json | +| models.SDKError | 4XX, 5XX | \*/\* | ## delete @@ -886,6 +888,97 @@ with Clerk( | models.ClerkErrors | 500 | application/json | | models.SDKError | 4XX, 5XX | \*/\* | +## get_billing_credit_balance + +Retrieves the current credit balance for the specified user. +Credits can be applied during checkout to reduce the charge or automatically applied to upcoming recurring charges + +### Example Usage + + +```python +from clerk_backend_api import Clerk + + +with Clerk( + bearer_auth="", +) as clerk: + + res = clerk.users.get_billing_credit_balance(user_id="") + + # Handle response + print(res) + +``` + +### Parameters + +| Parameter | Type | Required | Description | +| ------------------------------------------------------------------- | ------------------------------------------------------------------- | ------------------------------------------------------------------- | ------------------------------------------------------------------- | +| `user_id` | *str* | :heavy_check_mark: | The ID of the user whose credit balance to retrieve | +| `retries` | [Optional[utils.RetryConfig]](../../models/utils/retryconfig.md) | :heavy_minus_sign: | Configuration to override the default retry behavior of the client. | + +### Response + +**[models.CommerceCreditBalanceResponse](../../models/commercecreditbalanceresponse.md)** + +### Errors + +| Error Type | Status Code | Content Type | +| ----------------------- | ----------------------- | ----------------------- | +| models.ClerkErrors | 400, 401, 403, 404, 422 | application/json | +| models.ClerkErrors | 500 | application/json | +| models.SDKError | 4XX, 5XX | \*/\* | + +## adjust_billing_credit_balance + +Increases or decreases the credit balance for the specified user. +Each adjustment is recorded as a ledger entry. The idempotency_key parameter +ensures that duplicate requests are safely handled. + +### Example Usage + + +```python +import clerk_backend_api +from clerk_backend_api import Clerk + + +with Clerk( + bearer_auth="", +) as clerk: + + res = clerk.users.adjust_billing_credit_balance(user_id="", amount=562473, action=clerk_backend_api.Action.DECREASE, idempotency_key="", currency="New Israeli Sheqel", note="") + + # Handle response + print(res) + +``` + +### Parameters + +| Parameter | Type | Required | Description | +| --------------------------------------------------------------------------------------------------------------------------------- | --------------------------------------------------------------------------------------------------------------------------------- | --------------------------------------------------------------------------------------------------------------------------------- | --------------------------------------------------------------------------------------------------------------------------------- | +| `user_id` | *str* | :heavy_check_mark: | The ID of the user whose credit balance to adjust | +| `amount` | *int* | :heavy_check_mark: | The credit amount in cents. Must be greater than zero. | +| `action` | [models.Action](../../models/action.md) | :heavy_check_mark: | Whether to increase or decrease the credit balance. | +| `idempotency_key` | *str* | :heavy_check_mark: | A unique key to ensure the adjustment is applied only once. Repeated requests with the same key return the original ledger entry. | +| `currency` | *Optional[str]* | :heavy_minus_sign: | The currency code (e.g. "USD"). Defaults to USD if not provided. | +| `note` | *Optional[str]* | :heavy_minus_sign: | An optional note to attach to the ledger entry. | +| `retries` | [Optional[utils.RetryConfig]](../../models/utils/retryconfig.md) | :heavy_minus_sign: | Configuration to override the default retry behavior of the client. | + +### Response + +**[models.CommerceCreditLedgerResponse](../../models/commercecreditledgerresponse.md)** + +### Errors + +| Error Type | Status Code | Content Type | +| ---------------------------- | ---------------------------- | ---------------------------- | +| models.ClerkErrors | 400, 401, 403, 404, 409, 422 | application/json | +| models.ClerkErrors | 500 | application/json | +| models.SDKError | 4XX, 5XX | \*/\* | + ## get_o_auth_access_token Fetch the corresponding OAuth access token for a user that has previously authenticated with a particular OAuth provider. diff --git a/pyproject.toml b/pyproject.toml index a8219801..353a2e19 100644 --- a/pyproject.toml +++ b/pyproject.toml @@ -1,7 +1,7 @@ [project] name = "clerk-backend-api" -version = "5.0.2" +version = "5.0.3" description = "Python Client SDK for clerk.dev" authors = [{ name = "Clerk" },] readme = "README-PYPI.md" diff --git a/src/clerk_backend_api/_version.py b/src/clerk_backend_api/_version.py index 967f00ac..7336e85a 100644 --- a/src/clerk_backend_api/_version.py +++ b/src/clerk_backend_api/_version.py @@ -3,10 +3,10 @@ import importlib.metadata __title__: str = "clerk-backend-api" -__version__: str = "5.0.2" +__version__: str = "5.0.3" __openapi_doc_version__: str = "2025-11-10" -__gen_version__: str = "2.832.9" -__user_agent__: str = "speakeasy-sdk/python 5.0.2 2.832.9 2025-11-10 clerk-backend-api" +__gen_version__: str = "2.855.2" +__user_agent__: str = "speakeasy-sdk/python 5.0.3 2.855.2 2025-11-10 clerk-backend-api" try: if __package__ is not None: diff --git a/src/clerk_backend_api/agenttasks.py b/src/clerk_backend_api/agenttasks.py new file mode 100644 index 00000000..dcf9da19 --- /dev/null +++ b/src/clerk_backend_api/agenttasks.py @@ -0,0 +1,402 @@ +"""Code generated by Speakeasy (https://speakeasy.com). DO NOT EDIT.""" + +from .basesdk import BaseSDK +from clerk_backend_api import models, utils +from clerk_backend_api._hooks import HookContext +from clerk_backend_api.types import BaseModel, OptionalNullable, UNSET +from clerk_backend_api.utils.unmarshal_json_response import unmarshal_json_response +from typing import Any, Mapping, Optional, Union, cast + + +class AgentTasks(BaseSDK): + def create( + self, + *, + request: Optional[ + Union[ + models.CreateAgentTaskRequestBody, + models.CreateAgentTaskRequestBodyTypedDict, + ] + ] = None, + retries: OptionalNullable[utils.RetryConfig] = UNSET, + server_url: Optional[str] = None, + timeout_ms: Optional[int] = None, + http_headers: Optional[Mapping[str, str]] = None, + ) -> models.AgentTask: + r"""Create agent task + + Create an agent task on behalf of a user. + The response contains a URL that, when visited, creates a session for the user. + The agent_id is stable per agent_name within an instance. The task_id is unique per call. + + :param request: The request object to send. + :param retries: Override the default retry configuration for this method + :param server_url: Override the default server URL for this method + :param timeout_ms: Override the default request timeout configuration for this method in milliseconds + :param http_headers: Additional headers to set or replace on requests. + """ + base_url = None + url_variables = None + if timeout_ms is None: + timeout_ms = self.sdk_configuration.timeout_ms + + if server_url is not None: + base_url = server_url + else: + base_url = self._get_url(base_url, url_variables) + + if not isinstance(request, BaseModel): + request = utils.unmarshal( + request, Optional[models.CreateAgentTaskRequestBody] + ) + request = cast(Optional[models.CreateAgentTaskRequestBody], request) + + req = self._build_request( + method="POST", + path="/agents/tasks", + base_url=base_url, + url_variables=url_variables, + request=request, + request_body_required=False, + request_has_path_params=False, + request_has_query_params=True, + user_agent_header="user-agent", + accept_header_value="application/json", + http_headers=http_headers, + security=self.sdk_configuration.security, + get_serialized_body=lambda: utils.serialize_request_body( + request, + False, + True, + "json", + Optional[models.CreateAgentTaskRequestBody], + ), + allow_empty_value=None, + timeout_ms=timeout_ms, + ) + + if retries == UNSET: + if self.sdk_configuration.retry_config is not UNSET: + retries = self.sdk_configuration.retry_config + else: + retries = utils.RetryConfig( + "backoff", utils.BackoffStrategy(500, 60000, 1.5, 3600000), True + ) + + retry_config = None + if isinstance(retries, utils.RetryConfig): + retry_config = (retries, ["5XX"]) + + http_res = self.do_request( + hook_ctx=HookContext( + config=self.sdk_configuration, + base_url=base_url or "", + operation_id="CreateAgentTask", + oauth2_scopes=None, + security_source=self.sdk_configuration.security, + ), + request=req, + error_status_codes=["400", "404", "422", "4XX", "5XX"], + retry_config=retry_config, + ) + + response_data: Any = None + if utils.match_response(http_res, "200", "application/json"): + return unmarshal_json_response(models.AgentTask, http_res) + if utils.match_response(http_res, ["400", "404", "422"], "application/json"): + response_data = unmarshal_json_response(models.ClerkErrorsData, http_res) + raise models.ClerkErrors(response_data, http_res) + if utils.match_response(http_res, "4XX", "*"): + http_res_text = utils.stream_to_text(http_res) + raise models.SDKError("API error occurred", http_res, http_res_text) + if utils.match_response(http_res, "5XX", "*"): + http_res_text = utils.stream_to_text(http_res) + raise models.SDKError("API error occurred", http_res, http_res_text) + + raise models.SDKError("Unexpected response received", http_res) + + async def create_async( + self, + *, + request: Optional[ + Union[ + models.CreateAgentTaskRequestBody, + models.CreateAgentTaskRequestBodyTypedDict, + ] + ] = None, + retries: OptionalNullable[utils.RetryConfig] = UNSET, + server_url: Optional[str] = None, + timeout_ms: Optional[int] = None, + http_headers: Optional[Mapping[str, str]] = None, + ) -> models.AgentTask: + r"""Create agent task + + Create an agent task on behalf of a user. + The response contains a URL that, when visited, creates a session for the user. + The agent_id is stable per agent_name within an instance. The task_id is unique per call. + + :param request: The request object to send. + :param retries: Override the default retry configuration for this method + :param server_url: Override the default server URL for this method + :param timeout_ms: Override the default request timeout configuration for this method in milliseconds + :param http_headers: Additional headers to set or replace on requests. + """ + base_url = None + url_variables = None + if timeout_ms is None: + timeout_ms = self.sdk_configuration.timeout_ms + + if server_url is not None: + base_url = server_url + else: + base_url = self._get_url(base_url, url_variables) + + if not isinstance(request, BaseModel): + request = utils.unmarshal( + request, Optional[models.CreateAgentTaskRequestBody] + ) + request = cast(Optional[models.CreateAgentTaskRequestBody], request) + + req = self._build_request_async( + method="POST", + path="/agents/tasks", + base_url=base_url, + url_variables=url_variables, + request=request, + request_body_required=False, + request_has_path_params=False, + request_has_query_params=True, + user_agent_header="user-agent", + accept_header_value="application/json", + http_headers=http_headers, + security=self.sdk_configuration.security, + get_serialized_body=lambda: utils.serialize_request_body( + request, + False, + True, + "json", + Optional[models.CreateAgentTaskRequestBody], + ), + allow_empty_value=None, + timeout_ms=timeout_ms, + ) + + if retries == UNSET: + if self.sdk_configuration.retry_config is not UNSET: + retries = self.sdk_configuration.retry_config + else: + retries = utils.RetryConfig( + "backoff", utils.BackoffStrategy(500, 60000, 1.5, 3600000), True + ) + + retry_config = None + if isinstance(retries, utils.RetryConfig): + retry_config = (retries, ["5XX"]) + + http_res = await self.do_request_async( + hook_ctx=HookContext( + config=self.sdk_configuration, + base_url=base_url or "", + operation_id="CreateAgentTask", + oauth2_scopes=None, + security_source=self.sdk_configuration.security, + ), + request=req, + error_status_codes=["400", "404", "422", "4XX", "5XX"], + retry_config=retry_config, + ) + + response_data: Any = None + if utils.match_response(http_res, "200", "application/json"): + return unmarshal_json_response(models.AgentTask, http_res) + if utils.match_response(http_res, ["400", "404", "422"], "application/json"): + response_data = unmarshal_json_response(models.ClerkErrorsData, http_res) + raise models.ClerkErrors(response_data, http_res) + if utils.match_response(http_res, "4XX", "*"): + http_res_text = await utils.stream_to_text_async(http_res) + raise models.SDKError("API error occurred", http_res, http_res_text) + if utils.match_response(http_res, "5XX", "*"): + http_res_text = await utils.stream_to_text_async(http_res) + raise models.SDKError("API error occurred", http_res, http_res_text) + + raise models.SDKError("Unexpected response received", http_res) + + def revoke( + self, + *, + agent_task_id: str, + retries: OptionalNullable[utils.RetryConfig] = UNSET, + server_url: Optional[str] = None, + timeout_ms: Optional[int] = None, + http_headers: Optional[Mapping[str, str]] = None, + ) -> models.AgentTask: + r"""Revoke agent task + + Revokes a pending agent task. + + :param agent_task_id: The ID of the agent task to be revoked. + :param retries: Override the default retry configuration for this method + :param server_url: Override the default server URL for this method + :param timeout_ms: Override the default request timeout configuration for this method in milliseconds + :param http_headers: Additional headers to set or replace on requests. + """ + base_url = None + url_variables = None + if timeout_ms is None: + timeout_ms = self.sdk_configuration.timeout_ms + + if server_url is not None: + base_url = server_url + else: + base_url = self._get_url(base_url, url_variables) + + request = models.RevokeAgentTaskRequest( + agent_task_id=agent_task_id, + ) + + req = self._build_request( + method="POST", + path="/agents/tasks/{agent_task_id}/revoke", + base_url=base_url, + url_variables=url_variables, + request=request, + request_body_required=False, + request_has_path_params=True, + request_has_query_params=True, + user_agent_header="user-agent", + accept_header_value="application/json", + http_headers=http_headers, + security=self.sdk_configuration.security, + allow_empty_value=None, + timeout_ms=timeout_ms, + ) + + if retries == UNSET: + if self.sdk_configuration.retry_config is not UNSET: + retries = self.sdk_configuration.retry_config + else: + retries = utils.RetryConfig( + "backoff", utils.BackoffStrategy(500, 60000, 1.5, 3600000), True + ) + + retry_config = None + if isinstance(retries, utils.RetryConfig): + retry_config = (retries, ["5XX"]) + + http_res = self.do_request( + hook_ctx=HookContext( + config=self.sdk_configuration, + base_url=base_url or "", + operation_id="RevokeAgentTask", + oauth2_scopes=None, + security_source=self.sdk_configuration.security, + ), + request=req, + error_status_codes=["400", "404", "4XX", "5XX"], + retry_config=retry_config, + ) + + response_data: Any = None + if utils.match_response(http_res, "200", "application/json"): + return unmarshal_json_response(models.AgentTask, http_res) + if utils.match_response(http_res, ["400", "404"], "application/json"): + response_data = unmarshal_json_response(models.ClerkErrorsData, http_res) + raise models.ClerkErrors(response_data, http_res) + if utils.match_response(http_res, "4XX", "*"): + http_res_text = utils.stream_to_text(http_res) + raise models.SDKError("API error occurred", http_res, http_res_text) + if utils.match_response(http_res, "5XX", "*"): + http_res_text = utils.stream_to_text(http_res) + raise models.SDKError("API error occurred", http_res, http_res_text) + + raise models.SDKError("Unexpected response received", http_res) + + async def revoke_async( + self, + *, + agent_task_id: str, + retries: OptionalNullable[utils.RetryConfig] = UNSET, + server_url: Optional[str] = None, + timeout_ms: Optional[int] = None, + http_headers: Optional[Mapping[str, str]] = None, + ) -> models.AgentTask: + r"""Revoke agent task + + Revokes a pending agent task. + + :param agent_task_id: The ID of the agent task to be revoked. + :param retries: Override the default retry configuration for this method + :param server_url: Override the default server URL for this method + :param timeout_ms: Override the default request timeout configuration for this method in milliseconds + :param http_headers: Additional headers to set or replace on requests. + """ + base_url = None + url_variables = None + if timeout_ms is None: + timeout_ms = self.sdk_configuration.timeout_ms + + if server_url is not None: + base_url = server_url + else: + base_url = self._get_url(base_url, url_variables) + + request = models.RevokeAgentTaskRequest( + agent_task_id=agent_task_id, + ) + + req = self._build_request_async( + method="POST", + path="/agents/tasks/{agent_task_id}/revoke", + base_url=base_url, + url_variables=url_variables, + request=request, + request_body_required=False, + request_has_path_params=True, + request_has_query_params=True, + user_agent_header="user-agent", + accept_header_value="application/json", + http_headers=http_headers, + security=self.sdk_configuration.security, + allow_empty_value=None, + timeout_ms=timeout_ms, + ) + + if retries == UNSET: + if self.sdk_configuration.retry_config is not UNSET: + retries = self.sdk_configuration.retry_config + else: + retries = utils.RetryConfig( + "backoff", utils.BackoffStrategy(500, 60000, 1.5, 3600000), True + ) + + retry_config = None + if isinstance(retries, utils.RetryConfig): + retry_config = (retries, ["5XX"]) + + http_res = await self.do_request_async( + hook_ctx=HookContext( + config=self.sdk_configuration, + base_url=base_url or "", + operation_id="RevokeAgentTask", + oauth2_scopes=None, + security_source=self.sdk_configuration.security, + ), + request=req, + error_status_codes=["400", "404", "4XX", "5XX"], + retry_config=retry_config, + ) + + response_data: Any = None + if utils.match_response(http_res, "200", "application/json"): + return unmarshal_json_response(models.AgentTask, http_res) + if utils.match_response(http_res, ["400", "404"], "application/json"): + response_data = unmarshal_json_response(models.ClerkErrorsData, http_res) + raise models.ClerkErrors(response_data, http_res) + if utils.match_response(http_res, "4XX", "*"): + http_res_text = await utils.stream_to_text_async(http_res) + raise models.SDKError("API error occurred", http_res, http_res_text) + if utils.match_response(http_res, "5XX", "*"): + http_res_text = await utils.stream_to_text_async(http_res) + raise models.SDKError("API error occurred", http_res, http_res_text) + + raise models.SDKError("Unexpected response received", http_res) diff --git a/src/clerk_backend_api/emailaddresses.py b/src/clerk_backend_api/emailaddresses.py index 379f2198..3eb1181c 100644 --- a/src/clerk_backend_api/emailaddresses.py +++ b/src/clerk_backend_api/emailaddresses.py @@ -94,7 +94,7 @@ def create( security_source=self.sdk_configuration.security, ), request=req, - error_status_codes=["400", "401", "403", "404", "422", "4XX", "5XX"], + error_status_codes=["400", "401", "403", "404", "409", "422", "4XX", "5XX"], retry_config=retry_config, ) @@ -102,7 +102,7 @@ def create( if utils.match_response(http_res, "200", "application/json"): return unmarshal_json_response(models.EmailAddress, http_res) if utils.match_response( - http_res, ["400", "401", "403", "404", "422"], "application/json" + http_res, ["400", "401", "403", "404", "409", "422"], "application/json" ): response_data = unmarshal_json_response(models.ClerkErrorsData, http_res) raise models.ClerkErrors(response_data, http_res) @@ -200,7 +200,7 @@ async def create_async( security_source=self.sdk_configuration.security, ), request=req, - error_status_codes=["400", "401", "403", "404", "422", "4XX", "5XX"], + error_status_codes=["400", "401", "403", "404", "409", "422", "4XX", "5XX"], retry_config=retry_config, ) @@ -208,7 +208,7 @@ async def create_async( if utils.match_response(http_res, "200", "application/json"): return unmarshal_json_response(models.EmailAddress, http_res) if utils.match_response( - http_res, ["400", "401", "403", "404", "422"], "application/json" + http_res, ["400", "401", "403", "404", "409", "422"], "application/json" ): response_data = unmarshal_json_response(models.ClerkErrorsData, http_res) raise models.ClerkErrors(response_data, http_res) @@ -675,7 +675,7 @@ def update( security_source=self.sdk_configuration.security, ), request=req, - error_status_codes=["400", "401", "403", "404", "4XX", "5XX"], + error_status_codes=["400", "401", "403", "404", "409", "4XX", "5XX"], retry_config=retry_config, ) @@ -683,7 +683,7 @@ def update( if utils.match_response(http_res, "200", "application/json"): return unmarshal_json_response(models.EmailAddress, http_res) if utils.match_response( - http_res, ["400", "401", "403", "404"], "application/json" + http_res, ["400", "401", "403", "404", "409"], "application/json" ): response_data = unmarshal_json_response(models.ClerkErrorsData, http_res) raise models.ClerkErrors(response_data, http_res) @@ -782,7 +782,7 @@ async def update_async( security_source=self.sdk_configuration.security, ), request=req, - error_status_codes=["400", "401", "403", "404", "4XX", "5XX"], + error_status_codes=["400", "401", "403", "404", "409", "4XX", "5XX"], retry_config=retry_config, ) @@ -790,7 +790,7 @@ async def update_async( if utils.match_response(http_res, "200", "application/json"): return unmarshal_json_response(models.EmailAddress, http_res) if utils.match_response( - http_res, ["400", "401", "403", "404"], "application/json" + http_res, ["400", "401", "403", "404", "409"], "application/json" ): response_data = unmarshal_json_response(models.ClerkErrorsData, http_res) raise models.ClerkErrors(response_data, http_res) diff --git a/src/clerk_backend_api/instancesettings_sdk.py b/src/clerk_backend_api/instancesettings_sdk.py index 9a864e4c..5c1d11ce 100644 --- a/src/clerk_backend_api/instancesettings_sdk.py +++ b/src/clerk_backend_api/instancesettings_sdk.py @@ -577,6 +577,378 @@ async def update_restrictions_async( raise models.SDKError("Unexpected response received", http_res) + def get_o_auth_application_settings( + self, + *, + retries: OptionalNullable[utils.RetryConfig] = UNSET, + server_url: Optional[str] = None, + timeout_ms: Optional[int] = None, + http_headers: Optional[Mapping[str, str]] = None, + ) -> models.OAuthApplicationSettings: + r"""Get OAuth application settings + + Retrieves the settings for OAuth applications for the instance (dynamic client registration, JWT access tokens, etc.). + + :param retries: Override the default retry configuration for this method + :param server_url: Override the default server URL for this method + :param timeout_ms: Override the default request timeout configuration for this method in milliseconds + :param http_headers: Additional headers to set or replace on requests. + """ + base_url = None + url_variables = None + if timeout_ms is None: + timeout_ms = self.sdk_configuration.timeout_ms + + if server_url is not None: + base_url = server_url + else: + base_url = self._get_url(base_url, url_variables) + req = self._build_request( + method="GET", + path="/instance/oauth_application_settings", + base_url=base_url, + url_variables=url_variables, + request=None, + request_body_required=False, + request_has_path_params=False, + request_has_query_params=True, + user_agent_header="user-agent", + accept_header_value="application/json", + http_headers=http_headers, + security=self.sdk_configuration.security, + allow_empty_value=None, + timeout_ms=timeout_ms, + ) + + if retries == UNSET: + if self.sdk_configuration.retry_config is not UNSET: + retries = self.sdk_configuration.retry_config + else: + retries = utils.RetryConfig( + "backoff", utils.BackoffStrategy(500, 60000, 1.5, 3600000), True + ) + + retry_config = None + if isinstance(retries, utils.RetryConfig): + retry_config = (retries, ["5XX"]) + + http_res = self.do_request( + hook_ctx=HookContext( + config=self.sdk_configuration, + base_url=base_url or "", + operation_id="GetInstanceOAuthApplicationSettings", + oauth2_scopes=None, + security_source=self.sdk_configuration.security, + ), + request=req, + error_status_codes=["4XX", "5XX"], + retry_config=retry_config, + ) + + if utils.match_response(http_res, "200", "application/json"): + return unmarshal_json_response(models.OAuthApplicationSettings, http_res) + if utils.match_response(http_res, "4XX", "*"): + http_res_text = utils.stream_to_text(http_res) + raise models.SDKError("API error occurred", http_res, http_res_text) + if utils.match_response(http_res, "5XX", "*"): + http_res_text = utils.stream_to_text(http_res) + raise models.SDKError("API error occurred", http_res, http_res_text) + + raise models.SDKError("Unexpected response received", http_res) + + async def get_o_auth_application_settings_async( + self, + *, + retries: OptionalNullable[utils.RetryConfig] = UNSET, + server_url: Optional[str] = None, + timeout_ms: Optional[int] = None, + http_headers: Optional[Mapping[str, str]] = None, + ) -> models.OAuthApplicationSettings: + r"""Get OAuth application settings + + Retrieves the settings for OAuth applications for the instance (dynamic client registration, JWT access tokens, etc.). + + :param retries: Override the default retry configuration for this method + :param server_url: Override the default server URL for this method + :param timeout_ms: Override the default request timeout configuration for this method in milliseconds + :param http_headers: Additional headers to set or replace on requests. + """ + base_url = None + url_variables = None + if timeout_ms is None: + timeout_ms = self.sdk_configuration.timeout_ms + + if server_url is not None: + base_url = server_url + else: + base_url = self._get_url(base_url, url_variables) + req = self._build_request_async( + method="GET", + path="/instance/oauth_application_settings", + base_url=base_url, + url_variables=url_variables, + request=None, + request_body_required=False, + request_has_path_params=False, + request_has_query_params=True, + user_agent_header="user-agent", + accept_header_value="application/json", + http_headers=http_headers, + security=self.sdk_configuration.security, + allow_empty_value=None, + timeout_ms=timeout_ms, + ) + + if retries == UNSET: + if self.sdk_configuration.retry_config is not UNSET: + retries = self.sdk_configuration.retry_config + else: + retries = utils.RetryConfig( + "backoff", utils.BackoffStrategy(500, 60000, 1.5, 3600000), True + ) + + retry_config = None + if isinstance(retries, utils.RetryConfig): + retry_config = (retries, ["5XX"]) + + http_res = await self.do_request_async( + hook_ctx=HookContext( + config=self.sdk_configuration, + base_url=base_url or "", + operation_id="GetInstanceOAuthApplicationSettings", + oauth2_scopes=None, + security_source=self.sdk_configuration.security, + ), + request=req, + error_status_codes=["4XX", "5XX"], + retry_config=retry_config, + ) + + if utils.match_response(http_res, "200", "application/json"): + return unmarshal_json_response(models.OAuthApplicationSettings, http_res) + if utils.match_response(http_res, "4XX", "*"): + http_res_text = await utils.stream_to_text_async(http_res) + raise models.SDKError("API error occurred", http_res, http_res_text) + if utils.match_response(http_res, "5XX", "*"): + http_res_text = await utils.stream_to_text_async(http_res) + raise models.SDKError("API error occurred", http_res, http_res_text) + + raise models.SDKError("Unexpected response received", http_res) + + def update_o_auth_application_settings( + self, + *, + request: Optional[ + Union[ + models.UpdateInstanceOAuthApplicationSettingsRequestBody, + models.UpdateInstanceOAuthApplicationSettingsRequestBodyTypedDict, + ] + ] = None, + retries: OptionalNullable[utils.RetryConfig] = UNSET, + server_url: Optional[str] = None, + timeout_ms: Optional[int] = None, + http_headers: Optional[Mapping[str, str]] = None, + ) -> models.OAuthApplicationSettings: + r"""Update OAuth application settings + + Updates the OAuth application settings for the instance. + + :param request: The request object to send. + :param retries: Override the default retry configuration for this method + :param server_url: Override the default server URL for this method + :param timeout_ms: Override the default request timeout configuration for this method in milliseconds + :param http_headers: Additional headers to set or replace on requests. + """ + base_url = None + url_variables = None + if timeout_ms is None: + timeout_ms = self.sdk_configuration.timeout_ms + + if server_url is not None: + base_url = server_url + else: + base_url = self._get_url(base_url, url_variables) + + if not isinstance(request, BaseModel): + request = utils.unmarshal( + request, + Optional[models.UpdateInstanceOAuthApplicationSettingsRequestBody], + ) + request = cast( + Optional[models.UpdateInstanceOAuthApplicationSettingsRequestBody], request + ) + + req = self._build_request( + method="PATCH", + path="/instance/oauth_application_settings", + base_url=base_url, + url_variables=url_variables, + request=request, + request_body_required=False, + request_has_path_params=False, + request_has_query_params=True, + user_agent_header="user-agent", + accept_header_value="application/json", + http_headers=http_headers, + security=self.sdk_configuration.security, + get_serialized_body=lambda: utils.serialize_request_body( + request, + False, + True, + "json", + Optional[models.UpdateInstanceOAuthApplicationSettingsRequestBody], + ), + allow_empty_value=None, + timeout_ms=timeout_ms, + ) + + if retries == UNSET: + if self.sdk_configuration.retry_config is not UNSET: + retries = self.sdk_configuration.retry_config + else: + retries = utils.RetryConfig( + "backoff", utils.BackoffStrategy(500, 60000, 1.5, 3600000), True + ) + + retry_config = None + if isinstance(retries, utils.RetryConfig): + retry_config = (retries, ["5XX"]) + + http_res = self.do_request( + hook_ctx=HookContext( + config=self.sdk_configuration, + base_url=base_url or "", + operation_id="UpdateInstanceOAuthApplicationSettings", + oauth2_scopes=None, + security_source=self.sdk_configuration.security, + ), + request=req, + error_status_codes=["422", "4XX", "5XX"], + retry_config=retry_config, + ) + + response_data: Any = None + if utils.match_response(http_res, "200", "application/json"): + return unmarshal_json_response(models.OAuthApplicationSettings, http_res) + if utils.match_response(http_res, "422", "application/json"): + response_data = unmarshal_json_response(models.ClerkErrorsData, http_res) + raise models.ClerkErrors(response_data, http_res) + if utils.match_response(http_res, "4XX", "*"): + http_res_text = utils.stream_to_text(http_res) + raise models.SDKError("API error occurred", http_res, http_res_text) + if utils.match_response(http_res, "5XX", "*"): + http_res_text = utils.stream_to_text(http_res) + raise models.SDKError("API error occurred", http_res, http_res_text) + + raise models.SDKError("Unexpected response received", http_res) + + async def update_o_auth_application_settings_async( + self, + *, + request: Optional[ + Union[ + models.UpdateInstanceOAuthApplicationSettingsRequestBody, + models.UpdateInstanceOAuthApplicationSettingsRequestBodyTypedDict, + ] + ] = None, + retries: OptionalNullable[utils.RetryConfig] = UNSET, + server_url: Optional[str] = None, + timeout_ms: Optional[int] = None, + http_headers: Optional[Mapping[str, str]] = None, + ) -> models.OAuthApplicationSettings: + r"""Update OAuth application settings + + Updates the OAuth application settings for the instance. + + :param request: The request object to send. + :param retries: Override the default retry configuration for this method + :param server_url: Override the default server URL for this method + :param timeout_ms: Override the default request timeout configuration for this method in milliseconds + :param http_headers: Additional headers to set or replace on requests. + """ + base_url = None + url_variables = None + if timeout_ms is None: + timeout_ms = self.sdk_configuration.timeout_ms + + if server_url is not None: + base_url = server_url + else: + base_url = self._get_url(base_url, url_variables) + + if not isinstance(request, BaseModel): + request = utils.unmarshal( + request, + Optional[models.UpdateInstanceOAuthApplicationSettingsRequestBody], + ) + request = cast( + Optional[models.UpdateInstanceOAuthApplicationSettingsRequestBody], request + ) + + req = self._build_request_async( + method="PATCH", + path="/instance/oauth_application_settings", + base_url=base_url, + url_variables=url_variables, + request=request, + request_body_required=False, + request_has_path_params=False, + request_has_query_params=True, + user_agent_header="user-agent", + accept_header_value="application/json", + http_headers=http_headers, + security=self.sdk_configuration.security, + get_serialized_body=lambda: utils.serialize_request_body( + request, + False, + True, + "json", + Optional[models.UpdateInstanceOAuthApplicationSettingsRequestBody], + ), + allow_empty_value=None, + timeout_ms=timeout_ms, + ) + + if retries == UNSET: + if self.sdk_configuration.retry_config is not UNSET: + retries = self.sdk_configuration.retry_config + else: + retries = utils.RetryConfig( + "backoff", utils.BackoffStrategy(500, 60000, 1.5, 3600000), True + ) + + retry_config = None + if isinstance(retries, utils.RetryConfig): + retry_config = (retries, ["5XX"]) + + http_res = await self.do_request_async( + hook_ctx=HookContext( + config=self.sdk_configuration, + base_url=base_url or "", + operation_id="UpdateInstanceOAuthApplicationSettings", + oauth2_scopes=None, + security_source=self.sdk_configuration.security, + ), + request=req, + error_status_codes=["422", "4XX", "5XX"], + retry_config=retry_config, + ) + + response_data: Any = None + if utils.match_response(http_res, "200", "application/json"): + return unmarshal_json_response(models.OAuthApplicationSettings, http_res) + if utils.match_response(http_res, "422", "application/json"): + response_data = unmarshal_json_response(models.ClerkErrorsData, http_res) + raise models.ClerkErrors(response_data, http_res) + if utils.match_response(http_res, "4XX", "*"): + http_res_text = await utils.stream_to_text_async(http_res) + raise models.SDKError("API error occurred", http_res, http_res_text) + if utils.match_response(http_res, "5XX", "*"): + http_res_text = await utils.stream_to_text_async(http_res) + raise models.SDKError("API error occurred", http_res, http_res_text) + + raise models.SDKError("Unexpected response received", http_res) + def change_domain( self, *, diff --git a/src/clerk_backend_api/m2m.py b/src/clerk_backend_api/m2m.py index 658e691c..fd976952 100644 --- a/src/clerk_backend_api/m2m.py +++ b/src/clerk_backend_api/m2m.py @@ -12,6 +12,7 @@ class M2m(BaseSDK): def create_token( self, *, + token_format: Optional[models.TokenFormat] = models.TokenFormat.OPAQUE, seconds_until_expiration: OptionalNullable[float] = UNSET, claims: OptionalNullable[Any] = UNSET, retries: OptionalNullable[utils.RetryConfig] = UNSET, @@ -23,6 +24,7 @@ def create_token( Creates a new M2M Token. Must be authenticated via a Machine Secret Key. + :param token_format: :param seconds_until_expiration: :param claims: :param retries: Override the default retry configuration for this method @@ -41,6 +43,7 @@ def create_token( base_url = self._get_url(base_url, url_variables) request = models.CreateM2MTokenRequestBody( + token_format=token_format, seconds_until_expiration=seconds_until_expiration, claims=claims, ) @@ -115,6 +118,7 @@ def create_token( async def create_token_async( self, *, + token_format: Optional[models.TokenFormat] = models.TokenFormat.OPAQUE, seconds_until_expiration: OptionalNullable[float] = UNSET, claims: OptionalNullable[Any] = UNSET, retries: OptionalNullable[utils.RetryConfig] = UNSET, @@ -126,6 +130,7 @@ async def create_token_async( Creates a new M2M Token. Must be authenticated via a Machine Secret Key. + :param token_format: :param seconds_until_expiration: :param claims: :param retries: Override the default retry configuration for this method @@ -144,6 +149,7 @@ async def create_token_async( base_url = self._get_url(base_url, url_variables) request = models.CreateM2MTokenRequestBody( + token_format=token_format, seconds_until_expiration=seconds_until_expiration, claims=claims, ) @@ -232,6 +238,8 @@ def list_tokens( Fetches M2M tokens for a specific machine. + Only tokens created with the opaque token format are returned by this endpoint. JWT-format M2M tokens are stateless and are not stored. + This endpoint can be authenticated by either a Machine Secret Key or by a Clerk Secret Key. - When fetching M2M tokens with a Machine Secret Key, only tokens associated with the authenticated machine can be retrieved. @@ -351,6 +359,8 @@ async def list_tokens_async( Fetches M2M tokens for a specific machine. + Only tokens created with the opaque token format are returned by this endpoint. JWT-format M2M tokens are stateless and are not stored. + This endpoint can be authenticated by either a Machine Secret Key or by a Clerk Secret Key. - When fetching M2M tokens with a Machine Secret Key, only tokens associated with the authenticated machine can be retrieved. @@ -467,6 +477,8 @@ def revoke_token( Revokes a M2M Token. + This endpoint only revokes stored opaque-format M2M tokens. JWT-format M2M tokens are stateless and cannot be revoked. + This endpoint can be authenticated by either a Machine Secret Key or by a Clerk Secret Key. - When revoking a M2M Token with a Machine Secret Key, the token must managed by the Machine associated with the Machine Secret Key. @@ -581,6 +593,8 @@ async def revoke_token_async( Revokes a M2M Token. + This endpoint only revokes stored opaque-format M2M tokens. JWT-format M2M tokens are stateless and cannot be revoked. + This endpoint can be authenticated by either a Machine Secret Key or by a Clerk Secret Key. - When revoking a M2M Token with a Machine Secret Key, the token must managed by the Machine associated with the Machine Secret Key. diff --git a/src/clerk_backend_api/models/__init__.py b/src/clerk_backend_api/models/__init__.py index ba48fdf9..5f24128e 100644 --- a/src/clerk_backend_api/models/__init__.py +++ b/src/clerk_backend_api/models/__init__.py @@ -21,6 +21,20 @@ AddRolesToRoleSetRequestBodyTypedDict, AddRolesToRoleSetRequestTypedDict, ) + from .adjustcreditbalancerequest import ( + Action, + AdjustCreditBalanceRequest, + AdjustCreditBalanceRequestTypedDict, + ) + from .adjustorganizationbillingcreditbalanceop import ( + AdjustOrganizationBillingCreditBalanceRequest, + AdjustOrganizationBillingCreditBalanceRequestTypedDict, + ) + from .adjustuserbillingcreditbalanceop import ( + AdjustUserBillingCreditBalanceRequest, + AdjustUserBillingCreditBalanceRequestTypedDict, + ) + from .agenttask import AgentTask, AgentTaskObject, AgentTaskTypedDict from .allowlistidentifier import ( AllowlistIdentifier, AllowlistIdentifierObject, @@ -34,8 +48,16 @@ from .banuserop import BanUserRequest, BanUserRequestTypedDict from .billingpaymentattempt import ( BillingPaymentAttempt, + BillingPaymentAttemptCredits, + BillingPaymentAttemptCreditsTypedDict, BillingPaymentAttemptObject, + BillingPaymentAttemptPayer, + BillingPaymentAttemptPayerTypedDict, + BillingPaymentAttemptProration, + BillingPaymentAttemptProrationTypedDict, BillingPaymentAttemptStatus, + BillingPaymentAttemptTotals, + BillingPaymentAttemptTotalsTypedDict, BillingPaymentAttemptTypedDict, Payee, PayeeTypedDict, @@ -52,11 +74,11 @@ BillingStatementGroupsObject, BillingStatementObject, BillingStatementStatus, + BillingStatementTotals, + BillingStatementTotalsTypedDict, BillingStatementTypedDict, Groups, GroupsTypedDict, - Totals, - TotalsTypedDict, ) from .blocklistidentifier import ( BlocklistIdentifier, @@ -85,6 +107,16 @@ ) from .client import Client, ClientTypedDict, Object from .cnametarget import CNameTarget, CNameTargetTypedDict + from .commercecreditbalanceresponse import ( + Balance, + BalanceTypedDict, + CommerceCreditBalanceResponse, + CommerceCreditBalanceResponseTypedDict, + ) + from .commercecreditledgerresponse import ( + CommerceCreditLedgerResponse, + CommerceCreditLedgerResponseTypedDict, + ) from .commercemoneyresponse import ( CommerceMoneyResponse, CommerceMoneyResponseTypedDict, @@ -101,6 +133,14 @@ CommercePaymentMethodResponseTypedDict, PaymentType, ) + from .commerceperunittotal import ( + CommercePerUnitTotal, + CommercePerUnitTotalTypedDict, + ) + from .commerceperunittotaltier import ( + CommercePerUnitTotalTier, + CommercePerUnitTotalTierTypedDict, + ) from .commerceplan import ( AnnualFee, AnnualFeeTypedDict, @@ -110,6 +150,14 @@ CommercePlanObject, CommercePlanTypedDict, ) + from .commerceplanunitprice import ( + CommercePlanUnitPrice, + CommercePlanUnitPriceTypedDict, + ) + from .commerceplanunitpricetier import ( + CommercePlanUnitPriceTier, + CommercePlanUnitPriceTierTypedDict, + ) from .commercepricetransitiondetails import ( CommercePriceTransitionDetails, CommercePriceTransitionDetailsTypedDict, @@ -143,15 +191,31 @@ CommerceSubscriptionItemAnnualFeeTypedDict, CommerceSubscriptionItemAnnualMonthlyFee, CommerceSubscriptionItemAnnualMonthlyFeeTypedDict, + CommerceSubscriptionItemCredits, + CommerceSubscriptionItemCreditsTypedDict, CommerceSubscriptionItemObject, + CommerceSubscriptionItemPayer, + CommerceSubscriptionItemPayerTypedDict, CommerceSubscriptionItemPlanObject, + CommerceSubscriptionItemProration, + CommerceSubscriptionItemProrationTypedDict, CommerceSubscriptionItemStatus, + CommerceSubscriptionItemTotalsPayer, + CommerceSubscriptionItemTotalsPayerTypedDict, CommerceSubscriptionItemTypedDict, + Credits, + CreditsTypedDict, NextPayment, NextPaymentTypedDict, Plan, PlanPeriod, PlanTypedDict, + Proration, + ProrationTypedDict, + Seats, + SeatsTypedDict, + Totals, + TotalsTypedDict, ) from .commercesubscriptionnextpayment import ( CommerceSubscriptionNextPayment, @@ -164,6 +228,13 @@ CreateActorTokenRequestBody, CreateActorTokenRequestBodyTypedDict, ) + from .createagenttaskop import ( + CreateAgentTaskPermissions, + CreateAgentTaskRequestBody, + CreateAgentTaskRequestBodyTypedDict, + OnBehalfOf, + OnBehalfOfTypedDict, + ) from .createallowlistidentifierop import ( CreateAllowlistIdentifierRequestBody, CreateAllowlistIdentifierRequestBodyTypedDict, @@ -233,6 +304,7 @@ CreateM2MTokenRequestBodyTypedDict, CreateM2MTokenResponseBody, CreateM2MTokenResponseBodyTypedDict, + TokenFormat, ) from .createmachineop import ( CreateMachineRequestBody, @@ -699,6 +771,10 @@ GetOAuthApplicationRequest, GetOAuthApplicationRequestTypedDict, ) + from .getorganizationbillingcreditbalanceop import ( + GetOrganizationBillingCreditBalanceRequest, + GetOrganizationBillingCreditBalanceRequestTypedDict, + ) from .getorganizationbillingsubscriptionop import ( GetOrganizationBillingSubscriptionRequest, GetOrganizationBillingSubscriptionRequestTypedDict, @@ -747,6 +823,10 @@ GetTemplateRequestTypedDict, PathParamTemplateType, ) + from .getuserbillingcreditbalanceop import ( + GetUserBillingCreditBalanceRequest, + GetUserBillingCreditBalanceRequestTypedDict, + ) from .getuserbillingsubscriptionop import ( GetUserBillingSubscriptionRequest, GetUserBillingSubscriptionRequestTypedDict, @@ -920,6 +1000,11 @@ OAuthApplicationTypedDict, ) from .oauthapplications import OAuthApplications, OAuthApplicationsTypedDict + from .oauthapplicationsettings import ( + OAuthApplicationSettings, + OAuthApplicationSettingsObject, + OAuthApplicationSettingsTypedDict, + ) from .oauthapplicationwithsecret import ( OAuthApplicationWithSecret, OAuthApplicationWithSecretObject, @@ -1095,6 +1180,10 @@ RevokeActorTokenRequest, RevokeActorTokenRequestTypedDict, ) + from .revokeagenttaskop import ( + RevokeAgentTaskRequest, + RevokeAgentTaskRequestTypedDict, + ) from .revokeapikeyop import ( RevokeAPIKeyAPIKeysErrors, RevokeAPIKeyAPIKeysErrorsTypedDict, @@ -1369,6 +1458,10 @@ UpdateInstanceAuthConfigRequestBody, UpdateInstanceAuthConfigRequestBodyTypedDict, ) + from .updateinstanceoauthapplicationsettingsop import ( + UpdateInstanceOAuthApplicationSettingsRequestBody, + UpdateInstanceOAuthApplicationSettingsRequestBodyTypedDict, + ) from .updateinstanceop import ( UpdateInstanceRequestBody, UpdateInstanceRequestBodyTypedDict, @@ -1623,6 +1716,7 @@ ) __all__ = [ + "Action", "Actor", "ActorToken", "ActorTokenActor", @@ -1637,8 +1731,17 @@ "AddRolesToRoleSetRequestBody", "AddRolesToRoleSetRequestBodyTypedDict", "AddRolesToRoleSetRequestTypedDict", + "AdjustCreditBalanceRequest", + "AdjustCreditBalanceRequestTypedDict", + "AdjustOrganizationBillingCreditBalanceRequest", + "AdjustOrganizationBillingCreditBalanceRequestTypedDict", + "AdjustUserBillingCreditBalanceRequest", + "AdjustUserBillingCreditBalanceRequestTypedDict", "Admin", "AdminTypedDict", + "AgentTask", + "AgentTaskObject", + "AgentTaskTypedDict", "AllowlistIdentifier", "AllowlistIdentifierObject", "AllowlistIdentifierTypedDict", @@ -1652,11 +1755,21 @@ "AssignPermissionToOrganizationRoleRequestTypedDict", "AttributeMapping", "AttributeMappingTypedDict", + "Balance", + "BalanceTypedDict", "BanUserRequest", "BanUserRequestTypedDict", "BillingPaymentAttempt", + "BillingPaymentAttemptCredits", + "BillingPaymentAttemptCreditsTypedDict", "BillingPaymentAttemptObject", + "BillingPaymentAttemptPayer", + "BillingPaymentAttemptPayerTypedDict", + "BillingPaymentAttemptProration", + "BillingPaymentAttemptProrationTypedDict", "BillingPaymentAttemptStatus", + "BillingPaymentAttemptTotals", + "BillingPaymentAttemptTotalsTypedDict", "BillingPaymentAttemptTypedDict", "BillingPriceResponse", "BillingPriceResponseObject", @@ -1665,6 +1778,8 @@ "BillingStatementGroupsObject", "BillingStatementObject", "BillingStatementStatus", + "BillingStatementTotals", + "BillingStatementTotalsTypedDict", "BillingStatementTypedDict", "BlocklistIdentifier", "BlocklistIdentifierIdentifierType", @@ -1702,6 +1817,10 @@ "Client", "ClientTypedDict", "CodeType", + "CommerceCreditBalanceResponse", + "CommerceCreditBalanceResponseTypedDict", + "CommerceCreditLedgerResponse", + "CommerceCreditLedgerResponseTypedDict", "CommerceMoneyResponse", "CommerceMoneyResponseTypedDict", "CommercePayerResponse", @@ -1711,9 +1830,17 @@ "CommercePaymentMethodResponseObject", "CommercePaymentMethodResponseStatus", "CommercePaymentMethodResponseTypedDict", + "CommercePerUnitTotal", + "CommercePerUnitTotalTier", + "CommercePerUnitTotalTierTypedDict", + "CommercePerUnitTotalTypedDict", "CommercePlan", "CommercePlanObject", "CommercePlanTypedDict", + "CommercePlanUnitPrice", + "CommercePlanUnitPriceTier", + "CommercePlanUnitPriceTierTypedDict", + "CommercePlanUnitPriceTypedDict", "CommercePriceTransitionDetails", "CommercePriceTransitionDetailsTypedDict", "CommercePriceTransitionResponse", @@ -1729,9 +1856,17 @@ "CommerceSubscriptionItemAnnualFeeTypedDict", "CommerceSubscriptionItemAnnualMonthlyFee", "CommerceSubscriptionItemAnnualMonthlyFeeTypedDict", + "CommerceSubscriptionItemCredits", + "CommerceSubscriptionItemCreditsTypedDict", "CommerceSubscriptionItemObject", + "CommerceSubscriptionItemPayer", + "CommerceSubscriptionItemPayerTypedDict", "CommerceSubscriptionItemPlanObject", + "CommerceSubscriptionItemProration", + "CommerceSubscriptionItemProrationTypedDict", "CommerceSubscriptionItemStatus", + "CommerceSubscriptionItemTotalsPayer", + "CommerceSubscriptionItemTotalsPayerTypedDict", "CommerceSubscriptionItemTypedDict", "CommerceSubscriptionNextPayment", "CommerceSubscriptionNextPaymentTypedDict", @@ -1756,6 +1891,9 @@ "CreateActorTokenActorTypedDict", "CreateActorTokenRequestBody", "CreateActorTokenRequestBodyTypedDict", + "CreateAgentTaskPermissions", + "CreateAgentTaskRequestBody", + "CreateAgentTaskRequestBodyTypedDict", "CreateAllowlistIdentifierRequestBody", "CreateAllowlistIdentifierRequestBodyTypedDict", "CreateBillingPriceRequest", @@ -1855,6 +1993,8 @@ "CreatorRoleTypedDict", "Credit", "CreditTypedDict", + "Credits", + "CreditsTypedDict", "Data", "DataTypedDict", "DefaultRole", @@ -2065,6 +2205,8 @@ "GetOAuthAccessTokenRequestTypedDict", "GetOAuthApplicationRequest", "GetOAuthApplicationRequestTypedDict", + "GetOrganizationBillingCreditBalanceRequest", + "GetOrganizationBillingCreditBalanceRequestTypedDict", "GetOrganizationBillingSubscriptionRequest", "GetOrganizationBillingSubscriptionRequestTypedDict", "GetOrganizationInvitationRequest", @@ -2095,6 +2237,8 @@ "GetTemplateListRequestTypedDict", "GetTemplateRequest", "GetTemplateRequestTypedDict", + "GetUserBillingCreditBalanceRequest", + "GetUserBillingCreditBalanceRequestTypedDict", "GetUserBillingSubscriptionRequest", "GetUserBillingSubscriptionRequestTypedDict", "GetUserListRequest", @@ -2233,6 +2377,9 @@ "OAuthAccessTokenTypedDict", "OAuthApplication", "OAuthApplicationObject", + "OAuthApplicationSettings", + "OAuthApplicationSettingsObject", + "OAuthApplicationSettingsTypedDict", "OAuthApplicationTypedDict", "OAuthApplicationWithSecret", "OAuthApplicationWithSecretObject", @@ -2242,6 +2389,8 @@ "Oauth", "OauthTypedDict", "Object", + "OnBehalfOf", + "OnBehalfOfTypedDict", "One", "OneTypedDict", "Organization", @@ -2336,6 +2485,8 @@ "PreviousSubscriptionItemStatus", "PriceTransitionRequest", "PriceTransitionRequestTypedDict", + "Proration", + "ProrationTypedDict", "Protocol", "Provider", "ProxyCheck", @@ -2400,6 +2551,8 @@ "RevokeAPIKeyResponseBodyTypedDict", "RevokeActorTokenRequest", "RevokeActorTokenRequestTypedDict", + "RevokeAgentTaskRequest", + "RevokeAgentTaskRequestTypedDict", "RevokeInvitationRequest", "RevokeInvitationRequestTypedDict", "RevokeM2MTokenErrors", @@ -2500,6 +2653,8 @@ "SchemasSAMLConnection2Object", "SchemasSAMLConnectionObject", "SchemasSAMLConnectionTypedDict", + "Seats", + "SeatsTypedDict", "Security", "SecurityTypedDict", "Session", @@ -2555,6 +2710,7 @@ "ToggleTemplateDeliveryRequestBodyTypedDict", "ToggleTemplateDeliveryRequestTypedDict", "Token", + "TokenFormat", "TokenObject", "TokenTypedDict", "TotalCount", @@ -2596,6 +2752,8 @@ "UpdateEmailAddressRequestTypedDict", "UpdateInstanceAuthConfigRequestBody", "UpdateInstanceAuthConfigRequestBodyTypedDict", + "UpdateInstanceOAuthApplicationSettingsRequestBody", + "UpdateInstanceOAuthApplicationSettingsRequestBodyTypedDict", "UpdateInstanceOrganizationSettingsRequestBody", "UpdateInstanceOrganizationSettingsRequestBodyTypedDict", "UpdateInstanceProtectRequestBody", @@ -2877,6 +3035,16 @@ "AddRolesToRoleSetRequestBody": ".addrolestorolesetop", "AddRolesToRoleSetRequestBodyTypedDict": ".addrolestorolesetop", "AddRolesToRoleSetRequestTypedDict": ".addrolestorolesetop", + "Action": ".adjustcreditbalancerequest", + "AdjustCreditBalanceRequest": ".adjustcreditbalancerequest", + "AdjustCreditBalanceRequestTypedDict": ".adjustcreditbalancerequest", + "AdjustOrganizationBillingCreditBalanceRequest": ".adjustorganizationbillingcreditbalanceop", + "AdjustOrganizationBillingCreditBalanceRequestTypedDict": ".adjustorganizationbillingcreditbalanceop", + "AdjustUserBillingCreditBalanceRequest": ".adjustuserbillingcreditbalanceop", + "AdjustUserBillingCreditBalanceRequestTypedDict": ".adjustuserbillingcreditbalanceop", + "AgentTask": ".agenttask", + "AgentTaskObject": ".agenttask", + "AgentTaskTypedDict": ".agenttask", "AllowlistIdentifier": ".allowlistidentifier", "AllowlistIdentifierObject": ".allowlistidentifier", "AllowlistIdentifierTypedDict": ".allowlistidentifier", @@ -2886,8 +3054,16 @@ "BanUserRequest": ".banuserop", "BanUserRequestTypedDict": ".banuserop", "BillingPaymentAttempt": ".billingpaymentattempt", + "BillingPaymentAttemptCredits": ".billingpaymentattempt", + "BillingPaymentAttemptCreditsTypedDict": ".billingpaymentattempt", "BillingPaymentAttemptObject": ".billingpaymentattempt", + "BillingPaymentAttemptPayer": ".billingpaymentattempt", + "BillingPaymentAttemptPayerTypedDict": ".billingpaymentattempt", + "BillingPaymentAttemptProration": ".billingpaymentattempt", + "BillingPaymentAttemptProrationTypedDict": ".billingpaymentattempt", "BillingPaymentAttemptStatus": ".billingpaymentattempt", + "BillingPaymentAttemptTotals": ".billingpaymentattempt", + "BillingPaymentAttemptTotalsTypedDict": ".billingpaymentattempt", "BillingPaymentAttemptTypedDict": ".billingpaymentattempt", "Payee": ".billingpaymentattempt", "PayeeTypedDict": ".billingpaymentattempt", @@ -2900,11 +3076,11 @@ "BillingStatementGroupsObject": ".billingstatement", "BillingStatementObject": ".billingstatement", "BillingStatementStatus": ".billingstatement", + "BillingStatementTotals": ".billingstatement", + "BillingStatementTotalsTypedDict": ".billingstatement", "BillingStatementTypedDict": ".billingstatement", "Groups": ".billingstatement", "GroupsTypedDict": ".billingstatement", - "Totals": ".billingstatement", - "TotalsTypedDict": ".billingstatement", "BlocklistIdentifier": ".blocklistidentifier", "BlocklistIdentifierIdentifierType": ".blocklistidentifier", "BlocklistIdentifierObject": ".blocklistidentifier", @@ -2928,6 +3104,12 @@ "Object": ".client", "CNameTarget": ".cnametarget", "CNameTargetTypedDict": ".cnametarget", + "Balance": ".commercecreditbalanceresponse", + "BalanceTypedDict": ".commercecreditbalanceresponse", + "CommerceCreditBalanceResponse": ".commercecreditbalanceresponse", + "CommerceCreditBalanceResponseTypedDict": ".commercecreditbalanceresponse", + "CommerceCreditLedgerResponse": ".commercecreditledgerresponse", + "CommerceCreditLedgerResponseTypedDict": ".commercecreditledgerresponse", "CommerceMoneyResponse": ".commercemoneyresponse", "CommerceMoneyResponseTypedDict": ".commercemoneyresponse", "CommercePayerResponse": ".commercepayerresponse", @@ -2938,6 +3120,10 @@ "CommercePaymentMethodResponseStatus": ".commercepaymentmethodresponse", "CommercePaymentMethodResponseTypedDict": ".commercepaymentmethodresponse", "PaymentType": ".commercepaymentmethodresponse", + "CommercePerUnitTotal": ".commerceperunittotal", + "CommercePerUnitTotalTypedDict": ".commerceperunittotal", + "CommercePerUnitTotalTier": ".commerceperunittotaltier", + "CommercePerUnitTotalTierTypedDict": ".commerceperunittotaltier", "AnnualFee": ".commerceplan", "AnnualFeeTypedDict": ".commerceplan", "AnnualMonthlyFee": ".commerceplan", @@ -2945,6 +3131,10 @@ "CommercePlan": ".commerceplan", "CommercePlanObject": ".commerceplan", "CommercePlanTypedDict": ".commerceplan", + "CommercePlanUnitPrice": ".commerceplanunitprice", + "CommercePlanUnitPriceTypedDict": ".commerceplanunitprice", + "CommercePlanUnitPriceTier": ".commerceplanunitpricetier", + "CommercePlanUnitPriceTierTypedDict": ".commerceplanunitpricetier", "CommercePriceTransitionDetails": ".commercepricetransitiondetails", "CommercePriceTransitionDetailsTypedDict": ".commercepricetransitiondetails", "EffectiveMode": ".commercepricetransitiondetails", @@ -2969,15 +3159,31 @@ "CommerceSubscriptionItemAnnualFeeTypedDict": ".commercesubscriptionitem", "CommerceSubscriptionItemAnnualMonthlyFee": ".commercesubscriptionitem", "CommerceSubscriptionItemAnnualMonthlyFeeTypedDict": ".commercesubscriptionitem", + "CommerceSubscriptionItemCredits": ".commercesubscriptionitem", + "CommerceSubscriptionItemCreditsTypedDict": ".commercesubscriptionitem", "CommerceSubscriptionItemObject": ".commercesubscriptionitem", + "CommerceSubscriptionItemPayer": ".commercesubscriptionitem", + "CommerceSubscriptionItemPayerTypedDict": ".commercesubscriptionitem", "CommerceSubscriptionItemPlanObject": ".commercesubscriptionitem", + "CommerceSubscriptionItemProration": ".commercesubscriptionitem", + "CommerceSubscriptionItemProrationTypedDict": ".commercesubscriptionitem", "CommerceSubscriptionItemStatus": ".commercesubscriptionitem", + "CommerceSubscriptionItemTotalsPayer": ".commercesubscriptionitem", + "CommerceSubscriptionItemTotalsPayerTypedDict": ".commercesubscriptionitem", "CommerceSubscriptionItemTypedDict": ".commercesubscriptionitem", + "Credits": ".commercesubscriptionitem", + "CreditsTypedDict": ".commercesubscriptionitem", "NextPayment": ".commercesubscriptionitem", "NextPaymentTypedDict": ".commercesubscriptionitem", "Plan": ".commercesubscriptionitem", "PlanPeriod": ".commercesubscriptionitem", "PlanTypedDict": ".commercesubscriptionitem", + "Proration": ".commercesubscriptionitem", + "ProrationTypedDict": ".commercesubscriptionitem", + "Seats": ".commercesubscriptionitem", + "SeatsTypedDict": ".commercesubscriptionitem", + "Totals": ".commercesubscriptionitem", + "TotalsTypedDict": ".commercesubscriptionitem", "CommerceSubscriptionNextPayment": ".commercesubscriptionnextpayment", "CommerceSubscriptionNextPaymentTypedDict": ".commercesubscriptionnextpayment", "Cookies": ".cookies", @@ -2987,6 +3193,11 @@ "CreateActorTokenActorTypedDict": ".createactortokenop", "CreateActorTokenRequestBody": ".createactortokenop", "CreateActorTokenRequestBodyTypedDict": ".createactortokenop", + "CreateAgentTaskPermissions": ".createagenttaskop", + "CreateAgentTaskRequestBody": ".createagenttaskop", + "CreateAgentTaskRequestBodyTypedDict": ".createagenttaskop", + "OnBehalfOf": ".createagenttaskop", + "OnBehalfOfTypedDict": ".createagenttaskop", "CreateAllowlistIdentifierRequestBody": ".createallowlistidentifierop", "CreateAllowlistIdentifierRequestBodyTypedDict": ".createallowlistidentifierop", "CreateAPIKeyAPIKeysResponseBody": ".createapikeyop", @@ -3035,6 +3246,7 @@ "CreateM2MTokenRequestBodyTypedDict": ".createm2mtokenop", "CreateM2MTokenResponseBody": ".createm2mtokenop", "CreateM2MTokenResponseBodyTypedDict": ".createm2mtokenop", + "TokenFormat": ".createm2mtokenop", "CreateMachineRequestBody": ".createmachineop", "CreateMachineRequestBodyTypedDict": ".createmachineop", "CreateMachineScopeRequest": ".createmachinescopeop", @@ -3390,6 +3602,8 @@ "GetOAuthAccessTokenRequestTypedDict": ".getoauthaccesstokenop", "GetOAuthApplicationRequest": ".getoauthapplicationop", "GetOAuthApplicationRequestTypedDict": ".getoauthapplicationop", + "GetOrganizationBillingCreditBalanceRequest": ".getorganizationbillingcreditbalanceop", + "GetOrganizationBillingCreditBalanceRequestTypedDict": ".getorganizationbillingcreditbalanceop", "GetOrganizationBillingSubscriptionRequest": ".getorganizationbillingsubscriptionop", "GetOrganizationBillingSubscriptionRequestTypedDict": ".getorganizationbillingsubscriptionop", "GetOrganizationInvitationRequest": ".getorganizationinvitationop", @@ -3423,6 +3637,8 @@ "GetTemplateRequest": ".gettemplateop", "GetTemplateRequestTypedDict": ".gettemplateop", "PathParamTemplateType": ".gettemplateop", + "GetUserBillingCreditBalanceRequest": ".getuserbillingcreditbalanceop", + "GetUserBillingCreditBalanceRequestTypedDict": ".getuserbillingcreditbalanceop", "GetUserBillingSubscriptionRequest": ".getuserbillingsubscriptionop", "GetUserBillingSubscriptionRequestTypedDict": ".getuserbillingsubscriptionop", "GetUserListRequest": ".getuserlistop", @@ -3548,6 +3764,9 @@ "OAuthApplicationTypedDict": ".oauthapplication", "OAuthApplications": ".oauthapplications", "OAuthApplicationsTypedDict": ".oauthapplications", + "OAuthApplicationSettings": ".oauthapplicationsettings", + "OAuthApplicationSettingsObject": ".oauthapplicationsettings", + "OAuthApplicationSettingsTypedDict": ".oauthapplicationsettings", "OAuthApplicationWithSecret": ".oauthapplicationwithsecret", "OAuthApplicationWithSecretObject": ".oauthapplicationwithsecret", "OAuthApplicationWithSecretTypedDict": ".oauthapplicationwithsecret", @@ -3676,6 +3895,8 @@ "RevertTemplateRequestTypedDict": ".reverttemplateop", "RevokeActorTokenRequest": ".revokeactortokenop", "RevokeActorTokenRequestTypedDict": ".revokeactortokenop", + "RevokeAgentTaskRequest": ".revokeagenttaskop", + "RevokeAgentTaskRequestTypedDict": ".revokeagenttaskop", "RevokeAPIKeyAPIKeysErrors": ".revokeapikeyop", "RevokeAPIKeyAPIKeysErrorsTypedDict": ".revokeapikeyop", "RevokeAPIKeyAPIKeysResponseBody": ".revokeapikeyop", @@ -3916,6 +4137,8 @@ "UpdateEmailAddressRequestTypedDict": ".updateemailaddressop", "UpdateInstanceAuthConfigRequestBody": ".updateinstanceauthconfigop", "UpdateInstanceAuthConfigRequestBodyTypedDict": ".updateinstanceauthconfigop", + "UpdateInstanceOAuthApplicationSettingsRequestBody": ".updateinstanceoauthapplicationsettingsop", + "UpdateInstanceOAuthApplicationSettingsRequestBodyTypedDict": ".updateinstanceoauthapplicationsettingsop", "UpdateInstanceRequestBody": ".updateinstanceop", "UpdateInstanceRequestBodyTypedDict": ".updateinstanceop", "UpdateInstanceOrganizationSettingsRequestBody": ".updateinstanceorganizationsettingsop", diff --git a/src/clerk_backend_api/models/actortoken.py b/src/clerk_backend_api/models/actortoken.py index 021b2528..c8a0b799 100644 --- a/src/clerk_backend_api/models/actortoken.py +++ b/src/clerk_backend_api/models/actortoken.py @@ -81,7 +81,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) if val != UNSET_SENTINEL: if val is not None or k not in optional_fields: diff --git a/src/clerk_backend_api/models/adddomainop.py b/src/clerk_backend_api/models/adddomainop.py index e6525d6f..85379169 100644 --- a/src/clerk_backend_api/models/adddomainop.py +++ b/src/clerk_backend_api/models/adddomainop.py @@ -40,7 +40,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member diff --git a/src/clerk_backend_api/models/addrolestorolesetop.py b/src/clerk_backend_api/models/addrolestorolesetop.py index 7abbfe22..752b4900 100644 --- a/src/clerk_backend_api/models/addrolestorolesetop.py +++ b/src/clerk_backend_api/models/addrolestorolesetop.py @@ -39,7 +39,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) if val != UNSET_SENTINEL: if val is not None or k not in optional_fields: diff --git a/src/clerk_backend_api/models/adjustcreditbalancerequest.py b/src/clerk_backend_api/models/adjustcreditbalancerequest.py new file mode 100644 index 00000000..3518fe06 --- /dev/null +++ b/src/clerk_backend_api/models/adjustcreditbalancerequest.py @@ -0,0 +1,61 @@ +"""Code generated by Speakeasy (https://speakeasy.com). DO NOT EDIT.""" + +from __future__ import annotations +from clerk_backend_api.types import BaseModel, UNSET_SENTINEL +from enum import Enum +from pydantic import model_serializer +from typing import Optional +from typing_extensions import NotRequired, TypedDict + + +class Action(str, Enum): + r"""Whether to increase or decrease the credit balance.""" + + INCREASE = "increase" + DECREASE = "decrease" + + +class AdjustCreditBalanceRequestTypedDict(TypedDict): + amount: int + r"""The credit amount in cents. Must be greater than zero.""" + action: Action + r"""Whether to increase or decrease the credit balance.""" + idempotency_key: str + r"""A unique key to ensure the adjustment is applied only once. Repeated requests with the same key return the original ledger entry.""" + currency: NotRequired[str] + r"""The currency code (e.g. \"USD\"). Defaults to USD if not provided.""" + note: NotRequired[str] + r"""An optional note to attach to the ledger entry.""" + + +class AdjustCreditBalanceRequest(BaseModel): + amount: int + r"""The credit amount in cents. Must be greater than zero.""" + + action: Action + r"""Whether to increase or decrease the credit balance.""" + + idempotency_key: str + r"""A unique key to ensure the adjustment is applied only once. Repeated requests with the same key return the original ledger entry.""" + + currency: Optional[str] = None + r"""The currency code (e.g. \"USD\"). Defaults to USD if not provided.""" + + note: Optional[str] = None + r"""An optional note to attach to the ledger entry.""" + + @model_serializer(mode="wrap") + def serialize_model(self, handler): + optional_fields = set(["currency", "note"]) + serialized = handler(self) + m = {} + + for n, f in type(self).model_fields.items(): + k = f.alias or n + val = serialized.get(k, serialized.get(n)) + + if val != UNSET_SENTINEL: + if val is not None or k not in optional_fields: + m[k] = val + + return m diff --git a/src/clerk_backend_api/models/adjustorganizationbillingcreditbalanceop.py b/src/clerk_backend_api/models/adjustorganizationbillingcreditbalanceop.py new file mode 100644 index 00000000..88fcfa94 --- /dev/null +++ b/src/clerk_backend_api/models/adjustorganizationbillingcreditbalanceop.py @@ -0,0 +1,30 @@ +"""Code generated by Speakeasy (https://speakeasy.com). DO NOT EDIT.""" + +from __future__ import annotations +from .adjustcreditbalancerequest import ( + AdjustCreditBalanceRequest, + AdjustCreditBalanceRequestTypedDict, +) +from clerk_backend_api.types import BaseModel +from clerk_backend_api.utils import FieldMetadata, PathParamMetadata, RequestMetadata +from typing_extensions import Annotated, TypedDict + + +class AdjustOrganizationBillingCreditBalanceRequestTypedDict(TypedDict): + organization_id: str + r"""The ID of the organization whose credit balance to adjust""" + adjust_credit_balance_request: AdjustCreditBalanceRequestTypedDict + r"""Parameters for the credit balance adjustment""" + + +class AdjustOrganizationBillingCreditBalanceRequest(BaseModel): + organization_id: Annotated[ + str, FieldMetadata(path=PathParamMetadata(style="simple", explode=False)) + ] + r"""The ID of the organization whose credit balance to adjust""" + + adjust_credit_balance_request: Annotated[ + AdjustCreditBalanceRequest, + FieldMetadata(request=RequestMetadata(media_type="application/json")), + ] + r"""Parameters for the credit balance adjustment""" diff --git a/src/clerk_backend_api/models/adjustuserbillingcreditbalanceop.py b/src/clerk_backend_api/models/adjustuserbillingcreditbalanceop.py new file mode 100644 index 00000000..8278c928 --- /dev/null +++ b/src/clerk_backend_api/models/adjustuserbillingcreditbalanceop.py @@ -0,0 +1,30 @@ +"""Code generated by Speakeasy (https://speakeasy.com). DO NOT EDIT.""" + +from __future__ import annotations +from .adjustcreditbalancerequest import ( + AdjustCreditBalanceRequest, + AdjustCreditBalanceRequestTypedDict, +) +from clerk_backend_api.types import BaseModel +from clerk_backend_api.utils import FieldMetadata, PathParamMetadata, RequestMetadata +from typing_extensions import Annotated, TypedDict + + +class AdjustUserBillingCreditBalanceRequestTypedDict(TypedDict): + user_id: str + r"""The ID of the user whose credit balance to adjust""" + adjust_credit_balance_request: AdjustCreditBalanceRequestTypedDict + r"""Parameters for the credit balance adjustment""" + + +class AdjustUserBillingCreditBalanceRequest(BaseModel): + user_id: Annotated[ + str, FieldMetadata(path=PathParamMetadata(style="simple", explode=False)) + ] + r"""The ID of the user whose credit balance to adjust""" + + adjust_credit_balance_request: Annotated[ + AdjustCreditBalanceRequest, + FieldMetadata(request=RequestMetadata(media_type="application/json")), + ] + r"""Parameters for the credit balance adjustment""" diff --git a/src/clerk_backend_api/models/agenttask.py b/src/clerk_backend_api/models/agenttask.py new file mode 100644 index 00000000..74d2a705 --- /dev/null +++ b/src/clerk_backend_api/models/agenttask.py @@ -0,0 +1,67 @@ +"""Code generated by Speakeasy (https://speakeasy.com). DO NOT EDIT.""" + +from __future__ import annotations +from clerk_backend_api.types import BaseModel, UNSET_SENTINEL +from enum import Enum +from pydantic import model_serializer +from typing import Optional +from typing_extensions import NotRequired, TypedDict + + +class AgentTaskObject(str, Enum): + AGENT_TASK = "agent_task" + + +class AgentTaskTypedDict(TypedDict): + r"""Success""" + + object: AgentTaskObject + agent_id: str + r"""A stable identifier for the agent, unique per agent_name within an instance. + + """ + task_id: str + r"""A unique identifier for this agent task. + + """ + url: NotRequired[str] + r"""The URL that, when visited, creates a session for the user. Only present in the response to a create request. + + """ + + +class AgentTask(BaseModel): + r"""Success""" + + object: AgentTaskObject + + agent_id: str + r"""A stable identifier for the agent, unique per agent_name within an instance. + + """ + + task_id: str + r"""A unique identifier for this agent task. + + """ + + url: Optional[str] = None + r"""The URL that, when visited, creates a session for the user. Only present in the response to a create request. + + """ + + @model_serializer(mode="wrap") + def serialize_model(self, handler): + optional_fields = set(["url"]) + serialized = handler(self) + m = {} + + for n, f in type(self).model_fields.items(): + k = f.alias or n + val = serialized.get(k, serialized.get(n)) + + if val != UNSET_SENTINEL: + if val is not None or k not in optional_fields: + m[k] = val + + return m diff --git a/src/clerk_backend_api/models/allowlistidentifier.py b/src/clerk_backend_api/models/allowlistidentifier.py index 6fb00aa7..b30831ef 100644 --- a/src/clerk_backend_api/models/allowlistidentifier.py +++ b/src/clerk_backend_api/models/allowlistidentifier.py @@ -95,7 +95,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) if val != UNSET_SENTINEL: if val is not None or k not in optional_fields: diff --git a/src/clerk_backend_api/models/billingpaymentattempt.py b/src/clerk_backend_api/models/billingpaymentattempt.py index a5505467..4fbd856f 100644 --- a/src/clerk_backend_api/models/billingpaymentattempt.py +++ b/src/clerk_backend_api/models/billingpaymentattempt.py @@ -7,10 +7,17 @@ CommercePaymentMethodResponse, CommercePaymentMethodResponseTypedDict, ) -from clerk_backend_api.types import BaseModel, Nullable, UNSET_SENTINEL +from .commerceperunittotal import CommercePerUnitTotal, CommercePerUnitTotalTypedDict +from clerk_backend_api.types import ( + BaseModel, + Nullable, + OptionalNullable, + UNSET, + UNSET_SENTINEL, +) from enum import Enum from pydantic import model_serializer -from typing import Optional +from typing import List, Optional from typing_extensions import NotRequired, TypedDict @@ -36,6 +43,114 @@ class SubscriptionItem(BaseModel): r"""The subscription item associated with this payment attempt.""" +class BillingPaymentAttemptProrationTypedDict(TypedDict): + amount: CommerceMoneyResponseTypedDict + cycle_days_remaining: int + cycle_days_total: int + cycle_remaining_percent: float + + +class BillingPaymentAttemptProration(BaseModel): + amount: CommerceMoneyResponse + + cycle_days_remaining: int + + cycle_days_total: int + + cycle_remaining_percent: float + + +class BillingPaymentAttemptPayerTypedDict(TypedDict): + remaining_balance: CommerceMoneyResponseTypedDict + applied_amount: CommerceMoneyResponseTypedDict + + +class BillingPaymentAttemptPayer(BaseModel): + remaining_balance: CommerceMoneyResponse + + applied_amount: CommerceMoneyResponse + + +class BillingPaymentAttemptCreditsTypedDict(TypedDict): + proration: Nullable[BillingPaymentAttemptProrationTypedDict] + payer: Nullable[BillingPaymentAttemptPayerTypedDict] + total: CommerceMoneyResponseTypedDict + + +class BillingPaymentAttemptCredits(BaseModel): + proration: Nullable[BillingPaymentAttemptProration] + + payer: Nullable[BillingPaymentAttemptPayer] + + total: CommerceMoneyResponse + + @model_serializer(mode="wrap") + def serialize_model(self, handler): + serialized = handler(self) + m = {} + + for n, f in type(self).model_fields.items(): + k = f.alias or n + val = serialized.get(k, serialized.get(n)) + + if val != UNSET_SENTINEL: + m[k] = val + + return m + + +class BillingPaymentAttemptTotalsTypedDict(TypedDict): + r"""Totals breakdown for this payment attempt.""" + + subtotal: CommerceMoneyResponseTypedDict + base_fee: CommerceMoneyResponseTypedDict + tax_total: CommerceMoneyResponseTypedDict + grand_total: CommerceMoneyResponseTypedDict + per_unit_totals: NotRequired[List[CommercePerUnitTotalTypedDict]] + credits: NotRequired[Nullable[BillingPaymentAttemptCreditsTypedDict]] + + +class BillingPaymentAttemptTotals(BaseModel): + r"""Totals breakdown for this payment attempt.""" + + subtotal: CommerceMoneyResponse + + base_fee: CommerceMoneyResponse + + tax_total: CommerceMoneyResponse + + grand_total: CommerceMoneyResponse + + per_unit_totals: Optional[List[CommercePerUnitTotal]] = None + + credits: OptionalNullable[BillingPaymentAttemptCredits] = UNSET + + @model_serializer(mode="wrap") + def serialize_model(self, handler): + optional_fields = set(["per_unit_totals", "credits"]) + nullable_fields = set(["credits"]) + serialized = handler(self) + m = {} + + for n, f in type(self).model_fields.items(): + k = f.alias or n + val = serialized.get(k, serialized.get(n)) + is_nullable_and_explicitly_set = ( + k in nullable_fields + and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member + ) + + if val != UNSET_SENTINEL: + if ( + val is not None + or k not in optional_fields + or is_nullable_and_explicitly_set + ): + m[k] = val + + return m + + class BillingPaymentAttemptStatus(str, Enum): r"""The current status of the payment attempt.""" @@ -86,6 +201,8 @@ class BillingPaymentAttemptTypedDict(TypedDict): r"""Unique identifier for the associated subscription item.""" subscription_item: NotRequired[SubscriptionItemTypedDict] r"""The subscription item associated with this payment attempt.""" + totals: NotRequired[Nullable[BillingPaymentAttemptTotalsTypedDict]] + r"""Totals breakdown for this payment attempt.""" class BillingPaymentAttempt(BaseModel): @@ -152,18 +269,27 @@ class BillingPaymentAttempt(BaseModel): subscription_item: Optional[SubscriptionItem] = None r"""The subscription item associated with this payment attempt.""" + totals: OptionalNullable[BillingPaymentAttemptTotals] = UNSET + r"""Totals breakdown for this payment attempt.""" + @model_serializer(mode="wrap") def serialize_model(self, handler): - optional_fields = set(["subscription_item_id", "subscription_item"]) + optional_fields = set(["subscription_item_id", "subscription_item", "totals"]) nullable_fields = set( - ["gateway_external_id", "gateway_external_url", "paid_at", "failed_at"] + [ + "totals", + "gateway_external_id", + "gateway_external_url", + "paid_at", + "failed_at", + ] ) serialized = handler(self) m = {} for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member diff --git a/src/clerk_backend_api/models/billingpriceresponse.py b/src/clerk_backend_api/models/billingpriceresponse.py index d68c5862..6afea9f4 100644 --- a/src/clerk_backend_api/models/billingpriceresponse.py +++ b/src/clerk_backend_api/models/billingpriceresponse.py @@ -39,6 +39,8 @@ class BillingPriceResponseTypedDict(TypedDict): r"""The monthly amount in cents when billed annually.""" fee: CommerceMoneyResponseTypedDict annual_monthly_fee: CommerceMoneyResponseTypedDict + is_default: bool + r"""Whether this price is the default price for its plan.""" created_at: int r"""Unix timestamp (milliseconds) of creation.""" description: NotRequired[Nullable[str]] @@ -74,6 +76,9 @@ class BillingPriceResponse(BaseModel): annual_monthly_fee: CommerceMoneyResponse + is_default: bool + r"""Whether this price is the default price for its plan.""" + created_at: int r"""Unix timestamp (milliseconds) of creation.""" @@ -89,7 +94,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member diff --git a/src/clerk_backend_api/models/billingstatement.py b/src/clerk_backend_api/models/billingstatement.py index 66c0c8ac..a0cfa52b 100644 --- a/src/clerk_backend_api/models/billingstatement.py +++ b/src/clerk_backend_api/models/billingstatement.py @@ -23,21 +23,24 @@ class BillingStatementStatus(str, Enum): CLOSED = "closed" -class TotalsTypedDict(TypedDict): +class BillingStatementTotalsTypedDict(TypedDict): r"""Totals for the statement.""" grand_total: CommerceMoneyResponseTypedDict subtotal: CommerceMoneyResponseTypedDict + base_fee: CommerceMoneyResponseTypedDict tax_total: CommerceMoneyResponseTypedDict -class Totals(BaseModel): +class BillingStatementTotals(BaseModel): r"""Totals for the statement.""" grand_total: CommerceMoneyResponse subtotal: CommerceMoneyResponse + base_fee: CommerceMoneyResponse + tax_total: CommerceMoneyResponse @@ -83,7 +86,7 @@ class BillingStatementTypedDict(TypedDict): payer: CommercePayerResponseTypedDict status: BillingStatementStatus r"""The current status of the statement.""" - totals: TotalsTypedDict + totals: BillingStatementTotalsTypedDict r"""Totals for the statement.""" groups: List[GroupsTypedDict] r"""Array of statement groups.""" @@ -107,7 +110,7 @@ class BillingStatement(BaseModel): status: BillingStatementStatus r"""The current status of the statement.""" - totals: Totals + totals: BillingStatementTotals r"""Totals for the statement.""" groups: List[Groups] diff --git a/src/clerk_backend_api/models/blocklistidentifier.py b/src/clerk_backend_api/models/blocklistidentifier.py index 2fa3a59f..0865d247 100644 --- a/src/clerk_backend_api/models/blocklistidentifier.py +++ b/src/clerk_backend_api/models/blocklistidentifier.py @@ -87,7 +87,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) if val != UNSET_SENTINEL: if val is not None or k not in optional_fields: diff --git a/src/clerk_backend_api/models/cancelcommercesubscriptionitemop.py b/src/clerk_backend_api/models/cancelcommercesubscriptionitemop.py index 2a1c98fa..b6d622d7 100644 --- a/src/clerk_backend_api/models/cancelcommercesubscriptionitemop.py +++ b/src/clerk_backend_api/models/cancelcommercesubscriptionitemop.py @@ -35,7 +35,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) if val != UNSET_SENTINEL: if val is not None or k not in optional_fields: diff --git a/src/clerk_backend_api/models/changeproductioninstancedomainop.py b/src/clerk_backend_api/models/changeproductioninstancedomainop.py index cbf28f56..b6b17b50 100644 --- a/src/clerk_backend_api/models/changeproductioninstancedomainop.py +++ b/src/clerk_backend_api/models/changeproductioninstancedomainop.py @@ -35,7 +35,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) if val != UNSET_SENTINEL: if val is not None or k not in optional_fields: diff --git a/src/clerk_backend_api/models/clerkerror.py b/src/clerk_backend_api/models/clerkerror.py index 064eb405..dd3c123e 100644 --- a/src/clerk_backend_api/models/clerkerror.py +++ b/src/clerk_backend_api/models/clerkerror.py @@ -39,7 +39,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) if val != UNSET_SENTINEL: if val is not None or k not in optional_fields: diff --git a/src/clerk_backend_api/models/client.py b/src/clerk_backend_api/models/client.py index 6b8c03da..48a5e890 100644 --- a/src/clerk_backend_api/models/client.py +++ b/src/clerk_backend_api/models/client.py @@ -96,7 +96,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) if val != UNSET_SENTINEL: m[k] = val diff --git a/src/clerk_backend_api/models/commercecreditbalanceresponse.py b/src/clerk_backend_api/models/commercecreditbalanceresponse.py new file mode 100644 index 00000000..94bdb518 --- /dev/null +++ b/src/clerk_backend_api/models/commercecreditbalanceresponse.py @@ -0,0 +1,68 @@ +"""Code generated by Speakeasy (https://speakeasy.com). DO NOT EDIT.""" + +from __future__ import annotations +from clerk_backend_api.types import BaseModel, Nullable, UNSET_SENTINEL +from pydantic import model_serializer +from typing_extensions import TypedDict + + +class BalanceTypedDict(TypedDict): + r"""The current credit balance. Null when the payer has never had credits.""" + + amount: int + r"""The amount in cents.""" + amount_formatted: str + r"""The formatted amount as a string (e.g., \"$49.99\").""" + currency: str + r"""The currency code (e.g., \"USD\").""" + currency_symbol: str + r"""The currency symbol (e.g., \"$\").""" + + +class Balance(BaseModel): + r"""The current credit balance. Null when the payer has never had credits.""" + + amount: int + r"""The amount in cents.""" + + amount_formatted: str + r"""The formatted amount as a string (e.g., \"$49.99\").""" + + currency: str + r"""The currency code (e.g., \"USD\").""" + + currency_symbol: str + r"""The currency symbol (e.g., \"$\").""" + + +class CommerceCreditBalanceResponseTypedDict(TypedDict): + r"""A payer's credit balance.""" + + object: str + r"""String representing the object's type. Always \"commerce_credit_balance\".""" + balance: Nullable[BalanceTypedDict] + r"""The current credit balance. Null when the payer has never had credits.""" + + +class CommerceCreditBalanceResponse(BaseModel): + r"""A payer's credit balance.""" + + object: str + r"""String representing the object's type. Always \"commerce_credit_balance\".""" + + balance: Nullable[Balance] + r"""The current credit balance. Null when the payer has never had credits.""" + + @model_serializer(mode="wrap") + def serialize_model(self, handler): + serialized = handler(self) + m = {} + + for n, f in type(self).model_fields.items(): + k = f.alias or n + val = serialized.get(k, serialized.get(n)) + + if val != UNSET_SENTINEL: + m[k] = val + + return m diff --git a/src/clerk_backend_api/models/commercecreditledgerresponse.py b/src/clerk_backend_api/models/commercecreditledgerresponse.py new file mode 100644 index 00000000..1efd3525 --- /dev/null +++ b/src/clerk_backend_api/models/commercecreditledgerresponse.py @@ -0,0 +1,92 @@ +"""Code generated by Speakeasy (https://speakeasy.com). DO NOT EDIT.""" + +from __future__ import annotations +from clerk_backend_api.types import ( + BaseModel, + Nullable, + OptionalNullable, + UNSET, + UNSET_SENTINEL, +) +from datetime import datetime +from pydantic import model_serializer +from typing_extensions import NotRequired, TypedDict + + +class CommerceCreditLedgerResponseTypedDict(TypedDict): + r"""A credit ledger entry.""" + + object: str + r"""String representing the object's type. Always \"commerce_credit_ledger\".""" + id: str + r"""Unique identifier for the ledger entry.""" + payer_id: str + r"""The ID of the payer whose balance was adjusted.""" + amount: int + r"""The signed credit amount. Positive for increases, negative for decreases.""" + currency: str + r"""The currency code of the credit adjustment.""" + source_type: str + r"""The type of source that originated the adjustment (e.g. \"grant\").""" + source_id: str + r"""The ID of the source that originated the adjustment.""" + created_at: datetime + r"""Timestamp when the ledger entry was created.""" + note: NotRequired[Nullable[str]] + r"""An optional note attached to the ledger entry.""" + + +class CommerceCreditLedgerResponse(BaseModel): + r"""A credit ledger entry.""" + + object: str + r"""String representing the object's type. Always \"commerce_credit_ledger\".""" + + id: str + r"""Unique identifier for the ledger entry.""" + + payer_id: str + r"""The ID of the payer whose balance was adjusted.""" + + amount: int + r"""The signed credit amount. Positive for increases, negative for decreases.""" + + currency: str + r"""The currency code of the credit adjustment.""" + + source_type: str + r"""The type of source that originated the adjustment (e.g. \"grant\").""" + + source_id: str + r"""The ID of the source that originated the adjustment.""" + + created_at: datetime + r"""Timestamp when the ledger entry was created.""" + + note: OptionalNullable[str] = UNSET + r"""An optional note attached to the ledger entry.""" + + @model_serializer(mode="wrap") + def serialize_model(self, handler): + optional_fields = set(["note"]) + nullable_fields = set(["note"]) + serialized = handler(self) + m = {} + + for n, f in type(self).model_fields.items(): + k = f.alias or n + val = serialized.get(k, serialized.get(n)) + is_nullable_and_explicitly_set = ( + k in nullable_fields + and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member + ) + + if val != UNSET_SENTINEL: + if ( + val is not None + or k not in optional_fields + or is_nullable_and_explicitly_set + ): + m[k] = val + + return m diff --git a/src/clerk_backend_api/models/commercepayerresponse.py b/src/clerk_backend_api/models/commercepayerresponse.py index 70993e77..41eb11d7 100644 --- a/src/clerk_backend_api/models/commercepayerresponse.py +++ b/src/clerk_backend_api/models/commercepayerresponse.py @@ -119,7 +119,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member diff --git a/src/clerk_backend_api/models/commercepaymentmethodresponse.py b/src/clerk_backend_api/models/commercepaymentmethodresponse.py index 0137de4d..ff3d5d6d 100644 --- a/src/clerk_backend_api/models/commercepaymentmethodresponse.py +++ b/src/clerk_backend_api/models/commercepaymentmethodresponse.py @@ -151,7 +151,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member diff --git a/src/clerk_backend_api/models/commerceperunittotal.py b/src/clerk_backend_api/models/commerceperunittotal.py new file mode 100644 index 00000000..1b55e6cf --- /dev/null +++ b/src/clerk_backend_api/models/commerceperunittotal.py @@ -0,0 +1,30 @@ +"""Code generated by Speakeasy (https://speakeasy.com). DO NOT EDIT.""" + +from __future__ import annotations +from .commerceperunittotaltier import ( + CommercePerUnitTotalTier, + CommercePerUnitTotalTierTypedDict, +) +from clerk_backend_api.types import BaseModel +from typing import List +from typing_extensions import TypedDict + + +class CommercePerUnitTotalTypedDict(TypedDict): + name: str + r"""Name of the billable unit (for example, seats)""" + block_size: int + r"""Number of units included in each pricing block""" + tiers: List[CommercePerUnitTotalTierTypedDict] + r"""Computed totals for each pricing tier""" + + +class CommercePerUnitTotal(BaseModel): + name: str + r"""Name of the billable unit (for example, seats)""" + + block_size: int + r"""Number of units included in each pricing block""" + + tiers: List[CommercePerUnitTotalTier] + r"""Computed totals for each pricing tier""" diff --git a/src/clerk_backend_api/models/commerceperunittotaltier.py b/src/clerk_backend_api/models/commerceperunittotaltier.py new file mode 100644 index 00000000..5a279e4f --- /dev/null +++ b/src/clerk_backend_api/models/commerceperunittotaltier.py @@ -0,0 +1,54 @@ +"""Code generated by Speakeasy (https://speakeasy.com). DO NOT EDIT.""" + +from __future__ import annotations +from .commercemoneyresponse import CommerceMoneyResponse, CommerceMoneyResponseTypedDict +from clerk_backend_api.types import ( + BaseModel, + Nullable, + OptionalNullable, + UNSET, + UNSET_SENTINEL, +) +from pydantic import model_serializer +from typing_extensions import NotRequired, TypedDict + + +class CommercePerUnitTotalTierTypedDict(TypedDict): + fee_per_block: CommerceMoneyResponseTypedDict + total: CommerceMoneyResponseTypedDict + quantity: NotRequired[Nullable[int]] + r"""Units billed in this tier; null means unlimited""" + + +class CommercePerUnitTotalTier(BaseModel): + fee_per_block: CommerceMoneyResponse + + total: CommerceMoneyResponse + + quantity: OptionalNullable[int] = UNSET + r"""Units billed in this tier; null means unlimited""" + + @model_serializer(mode="wrap") + def serialize_model(self, handler): + optional_fields = set(["quantity"]) + nullable_fields = set(["quantity"]) + serialized = handler(self) + m = {} + + for n, f in type(self).model_fields.items(): + k = f.alias or n + val = serialized.get(k, serialized.get(n)) + is_nullable_and_explicitly_set = ( + k in nullable_fields + and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member + ) + + if val != UNSET_SENTINEL: + if ( + val is not None + or k not in optional_fields + or is_nullable_and_explicitly_set + ): + m[k] = val + + return m diff --git a/src/clerk_backend_api/models/commerceplan.py b/src/clerk_backend_api/models/commerceplan.py index f294f1aa..04437f23 100644 --- a/src/clerk_backend_api/models/commerceplan.py +++ b/src/clerk_backend_api/models/commerceplan.py @@ -2,6 +2,7 @@ from __future__ import annotations from .commercemoneyresponse import CommerceMoneyResponse, CommerceMoneyResponseTypedDict +from .commerceplanunitprice import CommercePlanUnitPrice, CommercePlanUnitPriceTypedDict from .featureresponse import FeatureResponse, FeatureResponseTypedDict from clerk_backend_api.types import BaseModel, Nullable, UNSET_SENTINEL from enum import Enum @@ -101,6 +102,8 @@ class CommercePlanTypedDict(TypedDict): r"""Number of free trial days for this plan.""" features: NotRequired[List[FeatureResponseTypedDict]] r"""The features included in this plan.""" + unit_prices: NotRequired[List[CommercePlanUnitPriceTypedDict]] + r"""Per-unit pricing tiers for this plan (for example, seats)""" class CommercePlan(BaseModel): @@ -160,9 +163,12 @@ class CommercePlan(BaseModel): features: Optional[List[FeatureResponse]] = None r"""The features included in this plan.""" + unit_prices: Optional[List[CommercePlanUnitPrice]] = None + r"""Per-unit pricing tiers for this plan (for example, seats)""" + @model_serializer(mode="wrap") def serialize_model(self, handler): - optional_fields = set(["features"]) + optional_fields = set(["features", "unit_prices"]) nullable_fields = set( [ "annual_monthly_fee", @@ -177,7 +183,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member diff --git a/src/clerk_backend_api/models/commerceplanunitprice.py b/src/clerk_backend_api/models/commerceplanunitprice.py new file mode 100644 index 00000000..341c3c51 --- /dev/null +++ b/src/clerk_backend_api/models/commerceplanunitprice.py @@ -0,0 +1,30 @@ +"""Code generated by Speakeasy (https://speakeasy.com). DO NOT EDIT.""" + +from __future__ import annotations +from .commerceplanunitpricetier import ( + CommercePlanUnitPriceTier, + CommercePlanUnitPriceTierTypedDict, +) +from clerk_backend_api.types import BaseModel +from typing import List +from typing_extensions import TypedDict + + +class CommercePlanUnitPriceTypedDict(TypedDict): + name: str + r"""Name of the billable unit (for example, seats)""" + block_size: int + r"""Number of units included in each pricing block""" + tiers: List[CommercePlanUnitPriceTierTypedDict] + r"""Tiered pricing configuration for this unit""" + + +class CommercePlanUnitPrice(BaseModel): + name: str + r"""Name of the billable unit (for example, seats)""" + + block_size: int + r"""Number of units included in each pricing block""" + + tiers: List[CommercePlanUnitPriceTier] + r"""Tiered pricing configuration for this unit""" diff --git a/src/clerk_backend_api/models/commerceplanunitpricetier.py b/src/clerk_backend_api/models/commerceplanunitpricetier.py new file mode 100644 index 00000000..704f0476 --- /dev/null +++ b/src/clerk_backend_api/models/commerceplanunitpricetier.py @@ -0,0 +1,56 @@ +"""Code generated by Speakeasy (https://speakeasy.com). DO NOT EDIT.""" + +from __future__ import annotations +from .commercemoneyresponse import CommerceMoneyResponse, CommerceMoneyResponseTypedDict +from clerk_backend_api.types import ( + BaseModel, + Nullable, + OptionalNullable, + UNSET, + UNSET_SENTINEL, +) +from pydantic import model_serializer +from typing_extensions import NotRequired, TypedDict + + +class CommercePlanUnitPriceTierTypedDict(TypedDict): + starts_at_block: int + r"""Start block (inclusive) for this tier""" + fee_per_block: CommerceMoneyResponseTypedDict + ends_after_block: NotRequired[Nullable[int]] + r"""End block (inclusive) for this tier; null means unlimited""" + + +class CommercePlanUnitPriceTier(BaseModel): + starts_at_block: int + r"""Start block (inclusive) for this tier""" + + fee_per_block: CommerceMoneyResponse + + ends_after_block: OptionalNullable[int] = UNSET + r"""End block (inclusive) for this tier; null means unlimited""" + + @model_serializer(mode="wrap") + def serialize_model(self, handler): + optional_fields = set(["ends_after_block"]) + nullable_fields = set(["ends_after_block"]) + serialized = handler(self) + m = {} + + for n, f in type(self).model_fields.items(): + k = f.alias or n + val = serialized.get(k, serialized.get(n)) + is_nullable_and_explicitly_set = ( + k in nullable_fields + and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member + ) + + if val != UNSET_SENTINEL: + if ( + val is not None + or k not in optional_fields + or is_nullable_and_explicitly_set + ): + m[k] = val + + return m diff --git a/src/clerk_backend_api/models/commercepricetransitiondetails.py b/src/clerk_backend_api/models/commercepricetransitiondetails.py index c2c049e5..7b27c7ca 100644 --- a/src/clerk_backend_api/models/commercepricetransitiondetails.py +++ b/src/clerk_backend_api/models/commercepricetransitiondetails.py @@ -113,7 +113,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member diff --git a/src/clerk_backend_api/models/commercesubscription.py b/src/clerk_backend_api/models/commercesubscription.py index 56bba50a..0cedc363 100644 --- a/src/clerk_backend_api/models/commercesubscription.py +++ b/src/clerk_backend_api/models/commercesubscription.py @@ -108,7 +108,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member diff --git a/src/clerk_backend_api/models/commercesubscriptioncreditresponse.py b/src/clerk_backend_api/models/commercesubscriptioncreditresponse.py index 24678d63..506a196f 100644 --- a/src/clerk_backend_api/models/commercesubscriptioncreditresponse.py +++ b/src/clerk_backend_api/models/commercesubscriptioncreditresponse.py @@ -65,7 +65,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member diff --git a/src/clerk_backend_api/models/commercesubscriptionitem.py b/src/clerk_backend_api/models/commercesubscriptionitem.py index 6faf7b56..6d41c6ee 100644 --- a/src/clerk_backend_api/models/commercesubscriptionitem.py +++ b/src/clerk_backend_api/models/commercesubscriptionitem.py @@ -7,6 +7,8 @@ CommercePaymentMethodResponse, CommercePaymentMethodResponseTypedDict, ) +from .commerceperunittotal import CommercePerUnitTotal, CommercePerUnitTotalTypedDict +from .commerceplanunitprice import CommercePlanUnitPrice, CommercePlanUnitPriceTypedDict from .commercesubscriptioncreditresponse import ( CommerceSubscriptionCreditResponse, CommerceSubscriptionCreditResponseTypedDict, @@ -46,6 +48,66 @@ class CommerceSubscriptionItemStatus(str, Enum): ABANDONED = "abandoned" +class ProrationTypedDict(TypedDict): + amount: CommerceMoneyResponseTypedDict + cycle_days_remaining: int + cycle_days_total: int + cycle_remaining_percent: float + + +class Proration(BaseModel): + amount: CommerceMoneyResponse + + cycle_days_remaining: int + + cycle_days_total: int + + cycle_remaining_percent: float + + +class CommerceSubscriptionItemPayerTypedDict(TypedDict): + remaining_balance: CommerceMoneyResponseTypedDict + applied_amount: CommerceMoneyResponseTypedDict + + +class CommerceSubscriptionItemPayer(BaseModel): + remaining_balance: CommerceMoneyResponse + + applied_amount: CommerceMoneyResponse + + +class CreditsTypedDict(TypedDict): + r"""Unified credits breakdown for this subscription item.""" + + proration: Nullable[ProrationTypedDict] + payer: Nullable[CommerceSubscriptionItemPayerTypedDict] + total: CommerceMoneyResponseTypedDict + + +class Credits(BaseModel): + r"""Unified credits breakdown for this subscription item.""" + + proration: Nullable[Proration] + + payer: Nullable[CommerceSubscriptionItemPayer] + + total: CommerceMoneyResponse + + @model_serializer(mode="wrap") + def serialize_model(self, handler): + serialized = handler(self) + m = {} + + for n, f in type(self).model_fields.items(): + k = f.alias or n + val = serialized.get(k, serialized.get(n)) + + if val != UNSET_SENTINEL: + m[k] = val + + return m + + class CommerceSubscriptionItemPlanObject(str, Enum): r"""String representing the object's type. Objects of the same type share the same value.""" @@ -138,6 +200,8 @@ class PlanTypedDict(TypedDict): r"""Number of free trial days for this plan.""" features: NotRequired[List[FeatureResponseTypedDict]] r"""The features included in this plan.""" + unit_prices: NotRequired[List[CommercePlanUnitPriceTypedDict]] + r"""Per-unit pricing tiers for this plan (for example, seats)""" class Plan(BaseModel): @@ -199,9 +263,12 @@ class Plan(BaseModel): features: Optional[List[FeatureResponse]] = None r"""The features included in this plan.""" + unit_prices: Optional[List[CommercePlanUnitPrice]] = None + r"""Per-unit pricing tiers for this plan (for example, seats)""" + @model_serializer(mode="wrap") def serialize_model(self, handler): - optional_fields = set(["features"]) + optional_fields = set(["features", "unit_prices"]) nullable_fields = set( [ "annual_monthly_fee", @@ -216,7 +283,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member @@ -296,7 +363,143 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) + is_nullable_and_explicitly_set = ( + k in nullable_fields + and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member + ) + + if val != UNSET_SENTINEL: + if ( + val is not None + or k not in optional_fields + or is_nullable_and_explicitly_set + ): + m[k] = val + + return m + + +class SeatsTypedDict(TypedDict): + r"""Seat quantity for seat-based billing.""" + + quantity: Nullable[int] + r"""Seat quantity being billed; null means unlimited""" + + +class Seats(BaseModel): + r"""Seat quantity for seat-based billing.""" + + quantity: Nullable[int] + r"""Seat quantity being billed; null means unlimited""" + + @model_serializer(mode="wrap") + def serialize_model(self, handler): + serialized = handler(self) + m = {} + + for n, f in type(self).model_fields.items(): + k = f.alias or n + val = serialized.get(k, serialized.get(n)) + + if val != UNSET_SENTINEL: + m[k] = val + + return m + + +class CommerceSubscriptionItemProrationTypedDict(TypedDict): + amount: CommerceMoneyResponseTypedDict + cycle_days_remaining: int + cycle_days_total: int + cycle_remaining_percent: float + + +class CommerceSubscriptionItemProration(BaseModel): + amount: CommerceMoneyResponse + + cycle_days_remaining: int + + cycle_days_total: int + + cycle_remaining_percent: float + + +class CommerceSubscriptionItemTotalsPayerTypedDict(TypedDict): + remaining_balance: CommerceMoneyResponseTypedDict + applied_amount: CommerceMoneyResponseTypedDict + + +class CommerceSubscriptionItemTotalsPayer(BaseModel): + remaining_balance: CommerceMoneyResponse + + applied_amount: CommerceMoneyResponse + + +class CommerceSubscriptionItemCreditsTypedDict(TypedDict): + proration: Nullable[CommerceSubscriptionItemProrationTypedDict] + payer: Nullable[CommerceSubscriptionItemTotalsPayerTypedDict] + total: CommerceMoneyResponseTypedDict + + +class CommerceSubscriptionItemCredits(BaseModel): + proration: Nullable[CommerceSubscriptionItemProration] + + payer: Nullable[CommerceSubscriptionItemTotalsPayer] + + total: CommerceMoneyResponse + + @model_serializer(mode="wrap") + def serialize_model(self, handler): + serialized = handler(self) + m = {} + + for n, f in type(self).model_fields.items(): + k = f.alias or n + val = serialized.get(k, serialized.get(n)) + + if val != UNSET_SENTINEL: + m[k] = val + + return m + + +class TotalsTypedDict(TypedDict): + r"""Totals for this subscription item.""" + + subtotal: CommerceMoneyResponseTypedDict + base_fee: CommerceMoneyResponseTypedDict + tax_total: CommerceMoneyResponseTypedDict + grand_total: CommerceMoneyResponseTypedDict + per_unit_totals: NotRequired[List[CommercePerUnitTotalTypedDict]] + credits: NotRequired[Nullable[CommerceSubscriptionItemCreditsTypedDict]] + + +class Totals(BaseModel): + r"""Totals for this subscription item.""" + + subtotal: CommerceMoneyResponse + + base_fee: CommerceMoneyResponse + + tax_total: CommerceMoneyResponse + + grand_total: CommerceMoneyResponse + + per_unit_totals: Optional[List[CommercePerUnitTotal]] = None + + credits: OptionalNullable[CommerceSubscriptionItemCredits] = UNSET + + @model_serializer(mode="wrap") + def serialize_model(self, handler): + optional_fields = set(["per_unit_totals", "credits"]) + nullable_fields = set(["credits"]) + serialized = handler(self) + m = {} + + for n, f in type(self).model_fields.items(): + k = f.alias or n + val = serialized.get(k, serialized.get(n)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member @@ -341,6 +544,8 @@ class CommerceSubscriptionItemTypedDict(TypedDict): ended_at: Nullable[int] r"""Unix timestamp (in milliseconds) when the subscription item ended.""" credit: NotRequired[CommerceSubscriptionCreditResponseTypedDict] + credits: NotRequired[Nullable[CreditsTypedDict]] + r"""Unified credits breakdown for this subscription item.""" price_id: NotRequired[str] r"""Unique identifier for the associated price""" plan: NotRequired[Nullable[PlanTypedDict]] @@ -356,6 +561,10 @@ class CommerceSubscriptionItemTypedDict(TypedDict): r"""Unix timestamp (in milliseconds) when the subscription item was created.""" updated_at: NotRequired[int] r"""Unix timestamp (in milliseconds) when the subscription item was last updated.""" + seats: NotRequired[Nullable[SeatsTypedDict]] + r"""Seat quantity for seat-based billing.""" + totals: NotRequired[Nullable[TotalsTypedDict]] + r"""Totals for this subscription item.""" class CommerceSubscriptionItem(BaseModel): @@ -400,6 +609,9 @@ class CommerceSubscriptionItem(BaseModel): credit: Optional[CommerceSubscriptionCreditResponse] = None + credits: OptionalNullable[Credits] = UNSET + r"""Unified credits breakdown for this subscription item.""" + price_id: Optional[str] = None r"""Unique identifier for the associated price""" @@ -424,11 +636,18 @@ class CommerceSubscriptionItem(BaseModel): updated_at: Optional[int] = None r"""Unix timestamp (in milliseconds) when the subscription item was last updated.""" + seats: OptionalNullable[Seats] = UNSET + r"""Seat quantity for seat-based billing.""" + + totals: OptionalNullable[Totals] = UNSET + r"""Totals for this subscription item.""" + @model_serializer(mode="wrap") def serialize_model(self, handler): optional_fields = set( [ "credit", + "credits", "price_id", "plan", "payment_method", @@ -438,10 +657,13 @@ def serialize_model(self, handler): "proration_date", "created_at", "updated_at", + "seats", + "totals", ] ) nullable_fields = set( [ + "credits", "plan_id", "plan", "next_payment", @@ -449,6 +671,8 @@ def serialize_model(self, handler): "canceled_at", "past_due_at", "ended_at", + "seats", + "totals", ] ) serialized = handler(self) @@ -456,7 +680,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member diff --git a/src/clerk_backend_api/models/createactortokenop.py b/src/clerk_backend_api/models/createactortokenop.py index 48e296f6..13b4eae2 100644 --- a/src/clerk_backend_api/models/createactortokenop.py +++ b/src/clerk_backend_api/models/createactortokenop.py @@ -83,7 +83,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) if val != UNSET_SENTINEL: if val is not None or k not in optional_fields: diff --git a/src/clerk_backend_api/models/createagenttaskop.py b/src/clerk_backend_api/models/createagenttaskop.py new file mode 100644 index 00000000..7b77eb7a --- /dev/null +++ b/src/clerk_backend_api/models/createagenttaskop.py @@ -0,0 +1,128 @@ +"""Code generated by Speakeasy (https://speakeasy.com). DO NOT EDIT.""" + +from __future__ import annotations +from clerk_backend_api.types import BaseModel, UNSET_SENTINEL +from enum import Enum +from pydantic import model_serializer +from typing import Optional +from typing_extensions import NotRequired, TypedDict + + +class OnBehalfOfTypedDict(TypedDict): + r"""Identifies the user on whose behalf the agent task is created. + Exactly one of user_id or identifier must be provided. + """ + + user_id: NotRequired[str] + r"""The ID of the user.""" + identifier: NotRequired[str] + r"""A verified identifier (e.g. email address) belonging to the user.""" + + +class OnBehalfOf(BaseModel): + r"""Identifies the user on whose behalf the agent task is created. + Exactly one of user_id or identifier must be provided. + """ + + user_id: Optional[str] = None + r"""The ID of the user.""" + + identifier: Optional[str] = None + r"""A verified identifier (e.g. email address) belonging to the user.""" + + @model_serializer(mode="wrap") + def serialize_model(self, handler): + optional_fields = set(["user_id", "identifier"]) + serialized = handler(self) + m = {} + + for n, f in type(self).model_fields.items(): + k = f.alias or n + val = serialized.get(k, serialized.get(n)) + + if val != UNSET_SENTINEL: + if val is not None or k not in optional_fields: + m[k] = val + + return m + + +class CreateAgentTaskPermissions(str, Enum): + r"""The permissions granted to the agent task. Must be \"*\" (all permissions).""" + + WILDCARD_ = "*" + + +class CreateAgentTaskRequestBodyTypedDict(TypedDict): + on_behalf_of: OnBehalfOfTypedDict + r"""Identifies the user on whose behalf the agent task is created. + Exactly one of user_id or identifier must be provided. + """ + permissions: CreateAgentTaskPermissions + r"""The permissions granted to the agent task. Must be \"*\" (all permissions).""" + agent_name: str + r"""A name identifying the agent. Used to derive a stable agent_id per instance. + Logged for audit purposes. + """ + task_description: str + r"""A description of the task being performed. Logged for audit purposes.""" + redirect_url: str + r"""The URL the user is redirected to after the agent task is accepted. + Must be a valid absolute URL with an `https` scheme in production instances. + In development instances, `http` is also permitted. + The URL's domain must belong to one of the instance's associated domains + (primary or satellite); otherwise the redirect will be rejected when the + task ticket is consumed. + """ + session_max_duration_in_seconds: NotRequired[int] + r"""The maximum duration that the session which will be created by the generated agent task should last. + By default, the duration of a session created via an agent task lasts 30 minutes. + """ + + +class CreateAgentTaskRequestBody(BaseModel): + on_behalf_of: OnBehalfOf + r"""Identifies the user on whose behalf the agent task is created. + Exactly one of user_id or identifier must be provided. + """ + + permissions: CreateAgentTaskPermissions + r"""The permissions granted to the agent task. Must be \"*\" (all permissions).""" + + agent_name: str + r"""A name identifying the agent. Used to derive a stable agent_id per instance. + Logged for audit purposes. + """ + + task_description: str + r"""A description of the task being performed. Logged for audit purposes.""" + + redirect_url: str + r"""The URL the user is redirected to after the agent task is accepted. + Must be a valid absolute URL with an `https` scheme in production instances. + In development instances, `http` is also permitted. + The URL's domain must belong to one of the instance's associated domains + (primary or satellite); otherwise the redirect will be rejected when the + task ticket is consumed. + """ + + session_max_duration_in_seconds: Optional[int] = 1800 + r"""The maximum duration that the session which will be created by the generated agent task should last. + By default, the duration of a session created via an agent task lasts 30 minutes. + """ + + @model_serializer(mode="wrap") + def serialize_model(self, handler): + optional_fields = set(["session_max_duration_in_seconds"]) + serialized = handler(self) + m = {} + + for n, f in type(self).model_fields.items(): + k = f.alias or n + val = serialized.get(k, serialized.get(n)) + + if val != UNSET_SENTINEL: + if val is not None or k not in optional_fields: + m[k] = val + + return m diff --git a/src/clerk_backend_api/models/createallowlistidentifierop.py b/src/clerk_backend_api/models/createallowlistidentifierop.py index 6e45fe42..00f88574 100644 --- a/src/clerk_backend_api/models/createallowlistidentifierop.py +++ b/src/clerk_backend_api/models/createallowlistidentifierop.py @@ -37,7 +37,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) if val != UNSET_SENTINEL: if val is not None or k not in optional_fields: diff --git a/src/clerk_backend_api/models/createapikeyop.py b/src/clerk_backend_api/models/createapikeyop.py index b252ed0d..37804622 100644 --- a/src/clerk_backend_api/models/createapikeyop.py +++ b/src/clerk_backend_api/models/createapikeyop.py @@ -65,7 +65,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member @@ -241,7 +241,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member diff --git a/src/clerk_backend_api/models/createbillingpricerequest.py b/src/clerk_backend_api/models/createbillingpricerequest.py index e714399b..245555b4 100644 --- a/src/clerk_backend_api/models/createbillingpricerequest.py +++ b/src/clerk_backend_api/models/createbillingpricerequest.py @@ -44,7 +44,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) if val != UNSET_SENTINEL: if val is not None or k not in optional_fields: diff --git a/src/clerk_backend_api/models/createbulkinvitationsop.py b/src/clerk_backend_api/models/createbulkinvitationsop.py index f75b6d2a..f244c646 100644 --- a/src/clerk_backend_api/models/createbulkinvitationsop.py +++ b/src/clerk_backend_api/models/createbulkinvitationsop.py @@ -102,7 +102,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member diff --git a/src/clerk_backend_api/models/createbulkwaitlistentriesop.py b/src/clerk_backend_api/models/createbulkwaitlistentriesop.py index 65daf556..8d6b314c 100644 --- a/src/clerk_backend_api/models/createbulkwaitlistentriesop.py +++ b/src/clerk_backend_api/models/createbulkwaitlistentriesop.py @@ -38,7 +38,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member diff --git a/src/clerk_backend_api/models/createemailaddressop.py b/src/clerk_backend_api/models/createemailaddressop.py index 406b8ac4..34c45a26 100644 --- a/src/clerk_backend_api/models/createemailaddressop.py +++ b/src/clerk_backend_api/models/createemailaddressop.py @@ -49,7 +49,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member diff --git a/src/clerk_backend_api/models/createinvitationop.py b/src/clerk_backend_api/models/createinvitationop.py index 21113731..9bb38efa 100644 --- a/src/clerk_backend_api/models/createinvitationop.py +++ b/src/clerk_backend_api/models/createinvitationop.py @@ -96,7 +96,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member diff --git a/src/clerk_backend_api/models/createjwttemplateop.py b/src/clerk_backend_api/models/createjwttemplateop.py index 52c65fa8..cee81a44 100644 --- a/src/clerk_backend_api/models/createjwttemplateop.py +++ b/src/clerk_backend_api/models/createjwttemplateop.py @@ -79,7 +79,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member diff --git a/src/clerk_backend_api/models/createm2mtokenop.py b/src/clerk_backend_api/models/createm2mtokenop.py index 56c5f284..3dfa31f7 100644 --- a/src/clerk_backend_api/models/createm2mtokenop.py +++ b/src/clerk_backend_api/models/createm2mtokenop.py @@ -17,26 +17,34 @@ from typing_extensions import NotRequired, TypedDict +class TokenFormat(str, Enum): + OPAQUE = "opaque" + JWT = "jwt" + + class CreateM2MTokenRequestBodyTypedDict(TypedDict): + token_format: NotRequired[TokenFormat] seconds_until_expiration: NotRequired[Nullable[float]] claims: NotRequired[Nullable[Any]] class CreateM2MTokenRequestBody(BaseModel): + token_format: Optional[TokenFormat] = TokenFormat.OPAQUE + seconds_until_expiration: OptionalNullable[float] = UNSET claims: OptionalNullable[Any] = UNSET @model_serializer(mode="wrap") def serialize_model(self, handler): - optional_fields = set(["seconds_until_expiration", "claims"]) + optional_fields = set(["token_format", "seconds_until_expiration", "claims"]) nullable_fields = set(["seconds_until_expiration", "claims"]) serialized = handler(self) m = {} for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member @@ -193,7 +201,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member diff --git a/src/clerk_backend_api/models/createmachineop.py b/src/clerk_backend_api/models/createmachineop.py index 3b4d5887..67a688e4 100644 --- a/src/clerk_backend_api/models/createmachineop.py +++ b/src/clerk_backend_api/models/createmachineop.py @@ -34,7 +34,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) if val != UNSET_SENTINEL: if val is not None or k not in optional_fields: diff --git a/src/clerk_backend_api/models/createmachinescopeop.py b/src/clerk_backend_api/models/createmachinescopeop.py index 037fddfe..48c4cf13 100644 --- a/src/clerk_backend_api/models/createmachinescopeop.py +++ b/src/clerk_backend_api/models/createmachinescopeop.py @@ -43,7 +43,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) if val != UNSET_SENTINEL: if val is not None or k not in optional_fields: diff --git a/src/clerk_backend_api/models/createoauthapplicationop.py b/src/clerk_backend_api/models/createoauthapplicationop.py index a1be54e0..ecde431d 100644 --- a/src/clerk_backend_api/models/createoauthapplicationop.py +++ b/src/clerk_backend_api/models/createoauthapplicationop.py @@ -89,7 +89,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member diff --git a/src/clerk_backend_api/models/createorganizationdomainop.py b/src/clerk_backend_api/models/createorganizationdomainop.py index a31ae200..57241543 100644 --- a/src/clerk_backend_api/models/createorganizationdomainop.py +++ b/src/clerk_backend_api/models/createorganizationdomainop.py @@ -42,7 +42,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member diff --git a/src/clerk_backend_api/models/createorganizationinvitationbulkop.py b/src/clerk_backend_api/models/createorganizationinvitationbulkop.py index 2c9e5224..b402a8e4 100644 --- a/src/clerk_backend_api/models/createorganizationinvitationbulkop.py +++ b/src/clerk_backend_api/models/createorganizationinvitationbulkop.py @@ -101,7 +101,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member diff --git a/src/clerk_backend_api/models/createorganizationinvitationop.py b/src/clerk_backend_api/models/createorganizationinvitationop.py index 2df11af4..b51d910f 100644 --- a/src/clerk_backend_api/models/createorganizationinvitationop.py +++ b/src/clerk_backend_api/models/createorganizationinvitationop.py @@ -101,7 +101,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member @@ -143,7 +143,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) if val != UNSET_SENTINEL: if val is not None or k not in optional_fields: diff --git a/src/clerk_backend_api/models/createorganizationmembershipop.py b/src/clerk_backend_api/models/createorganizationmembershipop.py index 166ea01e..a008cc2d 100644 --- a/src/clerk_backend_api/models/createorganizationmembershipop.py +++ b/src/clerk_backend_api/models/createorganizationmembershipop.py @@ -47,7 +47,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member diff --git a/src/clerk_backend_api/models/createorganizationop.py b/src/clerk_backend_api/models/createorganizationop.py index 5e9477d1..3f3503ee 100644 --- a/src/clerk_backend_api/models/createorganizationop.py +++ b/src/clerk_backend_api/models/createorganizationop.py @@ -100,7 +100,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member diff --git a/src/clerk_backend_api/models/createorganizationpermissionop.py b/src/clerk_backend_api/models/createorganizationpermissionop.py index 06af93cc..99166801 100644 --- a/src/clerk_backend_api/models/createorganizationpermissionop.py +++ b/src/clerk_backend_api/models/createorganizationpermissionop.py @@ -34,7 +34,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) if val != UNSET_SENTINEL: if val is not None or k not in optional_fields: diff --git a/src/clerk_backend_api/models/createorganizationroleop.py b/src/clerk_backend_api/models/createorganizationroleop.py index 2af8899a..e8787a67 100644 --- a/src/clerk_backend_api/models/createorganizationroleop.py +++ b/src/clerk_backend_api/models/createorganizationroleop.py @@ -55,7 +55,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member diff --git a/src/clerk_backend_api/models/createphonenumberop.py b/src/clerk_backend_api/models/createphonenumberop.py index 296b1e54..7c35b66f 100644 --- a/src/clerk_backend_api/models/createphonenumberop.py +++ b/src/clerk_backend_api/models/createphonenumberop.py @@ -54,7 +54,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member diff --git a/src/clerk_backend_api/models/createrolesetop.py b/src/clerk_backend_api/models/createrolesetop.py index 8ceabfc2..0f7ad341 100644 --- a/src/clerk_backend_api/models/createrolesetop.py +++ b/src/clerk_backend_api/models/createrolesetop.py @@ -91,7 +91,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member diff --git a/src/clerk_backend_api/models/createsamlconnectionop.py b/src/clerk_backend_api/models/createsamlconnectionop.py index ba940089..b9f43a36 100644 --- a/src/clerk_backend_api/models/createsamlconnectionop.py +++ b/src/clerk_backend_api/models/createsamlconnectionop.py @@ -52,7 +52,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) if val != UNSET_SENTINEL: if val is not None or k not in optional_fields: @@ -161,7 +161,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member @@ -215,7 +215,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) if val != UNSET_SENTINEL: if val is not None or k not in optional_fields: @@ -328,7 +328,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member diff --git a/src/clerk_backend_api/models/createsessionop.py b/src/clerk_backend_api/models/createsessionop.py index f89e69a5..e1515d74 100644 --- a/src/clerk_backend_api/models/createsessionop.py +++ b/src/clerk_backend_api/models/createsessionop.py @@ -29,7 +29,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) if val != UNSET_SENTINEL: if val is not None or k not in optional_fields: diff --git a/src/clerk_backend_api/models/createsessiontokenfromtemplateop.py b/src/clerk_backend_api/models/createsessiontokenfromtemplateop.py index 7f5a807d..7c91c3ff 100644 --- a/src/clerk_backend_api/models/createsessiontokenfromtemplateop.py +++ b/src/clerk_backend_api/models/createsessiontokenfromtemplateop.py @@ -33,7 +33,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member @@ -82,7 +82,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) if val != UNSET_SENTINEL: if val is not None or k not in optional_fields: @@ -117,7 +117,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) if val != UNSET_SENTINEL: if val is not None or k not in optional_fields: diff --git a/src/clerk_backend_api/models/createsessiontokenop.py b/src/clerk_backend_api/models/createsessiontokenop.py index 20e94f2d..acf76e59 100644 --- a/src/clerk_backend_api/models/createsessiontokenop.py +++ b/src/clerk_backend_api/models/createsessiontokenop.py @@ -33,7 +33,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member @@ -75,7 +75,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) if val != UNSET_SENTINEL: if val is not None or k not in optional_fields: @@ -110,7 +110,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) if val != UNSET_SENTINEL: if val is not None or k not in optional_fields: diff --git a/src/clerk_backend_api/models/createsignintokenop.py b/src/clerk_backend_api/models/createsignintokenop.py index b665cfde..162d767c 100644 --- a/src/clerk_backend_api/models/createsignintokenop.py +++ b/src/clerk_backend_api/models/createsignintokenop.py @@ -38,7 +38,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member diff --git a/src/clerk_backend_api/models/createuserop.py b/src/clerk_backend_api/models/createuserop.py index f205ba78..e2a27410 100644 --- a/src/clerk_backend_api/models/createuserop.py +++ b/src/clerk_backend_api/models/createuserop.py @@ -312,7 +312,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member diff --git a/src/clerk_backend_api/models/createwaitlistentryop.py b/src/clerk_backend_api/models/createwaitlistentryop.py index e84a44ec..9ffca525 100644 --- a/src/clerk_backend_api/models/createwaitlistentryop.py +++ b/src/clerk_backend_api/models/createwaitlistentryop.py @@ -38,7 +38,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member diff --git a/src/clerk_backend_api/models/deletebackupcodeop.py b/src/clerk_backend_api/models/deletebackupcodeop.py index 2565eb34..1b539c08 100644 --- a/src/clerk_backend_api/models/deletebackupcodeop.py +++ b/src/clerk_backend_api/models/deletebackupcodeop.py @@ -39,7 +39,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) if val != UNSET_SENTINEL: if val is not None or k not in optional_fields: diff --git a/src/clerk_backend_api/models/deletedobject.py b/src/clerk_backend_api/models/deletedobject.py index b877d03b..b8d6c65b 100644 --- a/src/clerk_backend_api/models/deletedobject.py +++ b/src/clerk_backend_api/models/deletedobject.py @@ -38,7 +38,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) if val != UNSET_SENTINEL: if val is not None or k not in optional_fields: diff --git a/src/clerk_backend_api/models/deletetotpop.py b/src/clerk_backend_api/models/deletetotpop.py index 0115c3e7..9591d87c 100644 --- a/src/clerk_backend_api/models/deletetotpop.py +++ b/src/clerk_backend_api/models/deletetotpop.py @@ -39,7 +39,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) if val != UNSET_SENTINEL: if val is not None or k not in optional_fields: diff --git a/src/clerk_backend_api/models/disablemfaop.py b/src/clerk_backend_api/models/disablemfaop.py index fdbf2213..6cd29d9a 100644 --- a/src/clerk_backend_api/models/disablemfaop.py +++ b/src/clerk_backend_api/models/disablemfaop.py @@ -39,7 +39,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) if val != UNSET_SENTINEL: if val is not None or k not in optional_fields: diff --git a/src/clerk_backend_api/models/domain.py b/src/clerk_backend_api/models/domain.py index 45080d0c..c297fb6c 100644 --- a/src/clerk_backend_api/models/domain.py +++ b/src/clerk_backend_api/models/domain.py @@ -65,7 +65,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member diff --git a/src/clerk_backend_api/models/emailaddress.py b/src/clerk_backend_api/models/emailaddress.py index ebc26505..cedaf509 100644 --- a/src/clerk_backend_api/models/emailaddress.py +++ b/src/clerk_backend_api/models/emailaddress.py @@ -69,7 +69,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member @@ -134,7 +134,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) if val != UNSET_SENTINEL: if val is not None or k not in optional_fields: @@ -202,7 +202,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member @@ -273,7 +273,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member @@ -331,7 +331,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) if val != UNSET_SENTINEL: if val is not None or k not in optional_fields: @@ -380,7 +380,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member @@ -449,7 +449,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member @@ -523,7 +523,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member @@ -643,7 +643,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member diff --git a/src/clerk_backend_api/models/enterpriseaccount.py b/src/clerk_backend_api/models/enterpriseaccount.py index 2582c3c2..66acb9a5 100644 --- a/src/clerk_backend_api/models/enterpriseaccount.py +++ b/src/clerk_backend_api/models/enterpriseaccount.py @@ -76,7 +76,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) if val != UNSET_SENTINEL: if val is not None or k not in optional_fields: @@ -152,7 +152,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member @@ -217,7 +217,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) if val != UNSET_SENTINEL: if val is not None or k not in optional_fields: @@ -291,7 +291,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member @@ -366,7 +366,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member @@ -475,7 +475,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member @@ -564,7 +564,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member @@ -695,7 +695,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member diff --git a/src/clerk_backend_api/models/externalaccountwithverification.py b/src/clerk_backend_api/models/externalaccountwithverification.py index af4c678b..a00240ce 100644 --- a/src/clerk_backend_api/models/externalaccountwithverification.py +++ b/src/clerk_backend_api/models/externalaccountwithverification.py @@ -76,7 +76,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) if val != UNSET_SENTINEL: if val is not None or k not in optional_fields: @@ -127,7 +127,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member @@ -188,7 +188,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) if val != UNSET_SENTINEL: if val is not None or k not in optional_fields: @@ -256,7 +256,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member @@ -418,8 +418,8 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) - serialized.pop(k, None) + val = serialized.get(k, serialized.get(n)) + serialized.pop(k, serialized.pop(n, None)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member diff --git a/src/clerk_backend_api/models/featureresponse.py b/src/clerk_backend_api/models/featureresponse.py index 0843f3e3..4e3156b2 100644 --- a/src/clerk_backend_api/models/featureresponse.py +++ b/src/clerk_backend_api/models/featureresponse.py @@ -54,7 +54,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) if val != UNSET_SENTINEL: m[k] = val diff --git a/src/clerk_backend_api/models/getapikeyop.py b/src/clerk_backend_api/models/getapikeyop.py index 25db1110..f493b4e6 100644 --- a/src/clerk_backend_api/models/getapikeyop.py +++ b/src/clerk_backend_api/models/getapikeyop.py @@ -187,7 +187,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member diff --git a/src/clerk_backend_api/models/getapikeysop.py b/src/clerk_backend_api/models/getapikeysop.py index e96843c7..30f6d11f 100644 --- a/src/clerk_backend_api/models/getapikeysop.py +++ b/src/clerk_backend_api/models/getapikeysop.py @@ -71,7 +71,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member @@ -240,7 +240,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member diff --git a/src/clerk_backend_api/models/getbillingpricelistop.py b/src/clerk_backend_api/models/getbillingpricelistop.py index 50d62dfb..e36a1d29 100644 --- a/src/clerk_backend_api/models/getbillingpricelistop.py +++ b/src/clerk_backend_api/models/getbillingpricelistop.py @@ -68,7 +68,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) if val != UNSET_SENTINEL: if val is not None or k not in optional_fields: diff --git a/src/clerk_backend_api/models/getbillingstatementlistop.py b/src/clerk_backend_api/models/getbillingstatementlistop.py index 00de5ed1..6cb8ea3a 100644 --- a/src/clerk_backend_api/models/getbillingstatementlistop.py +++ b/src/clerk_backend_api/models/getbillingstatementlistop.py @@ -60,7 +60,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) if val != UNSET_SENTINEL: if val is not None or k not in optional_fields: diff --git a/src/clerk_backend_api/models/getbillingstatementpaymentattemptsop.py b/src/clerk_backend_api/models/getbillingstatementpaymentattemptsop.py index 030342fc..31fa51e5 100644 --- a/src/clerk_backend_api/models/getbillingstatementpaymentattemptsop.py +++ b/src/clerk_backend_api/models/getbillingstatementpaymentattemptsop.py @@ -70,7 +70,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) if val != UNSET_SENTINEL: if val is not None or k not in optional_fields: diff --git a/src/clerk_backend_api/models/getclientlistop.py b/src/clerk_backend_api/models/getclientlistop.py index dccb9264..187471b0 100644 --- a/src/clerk_backend_api/models/getclientlistop.py +++ b/src/clerk_backend_api/models/getclientlistop.py @@ -60,7 +60,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) if val != UNSET_SENTINEL: if val is not None or k not in optional_fields: diff --git a/src/clerk_backend_api/models/getcommerceplanlistop.py b/src/clerk_backend_api/models/getcommerceplanlistop.py index 26ca1096..f8f0c45f 100644 --- a/src/clerk_backend_api/models/getcommerceplanlistop.py +++ b/src/clerk_backend_api/models/getcommerceplanlistop.py @@ -76,7 +76,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) if val != UNSET_SENTINEL: if val is not None or k not in optional_fields: diff --git a/src/clerk_backend_api/models/getcommercesubscriptionitemlistop.py b/src/clerk_backend_api/models/getcommercesubscriptionitemlistop.py index fa30888e..0541196b 100644 --- a/src/clerk_backend_api/models/getcommercesubscriptionitemlistop.py +++ b/src/clerk_backend_api/models/getcommercesubscriptionitemlistop.py @@ -129,7 +129,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) if val != UNSET_SENTINEL: if val is not None or k not in optional_fields: diff --git a/src/clerk_backend_api/models/getm2mtokensop.py b/src/clerk_backend_api/models/getm2mtokensop.py index b8f3d7c8..27f9b279 100644 --- a/src/clerk_backend_api/models/getm2mtokensop.py +++ b/src/clerk_backend_api/models/getm2mtokensop.py @@ -60,7 +60,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member @@ -245,7 +245,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member diff --git a/src/clerk_backend_api/models/getoauthaccesstokenop.py b/src/clerk_backend_api/models/getoauthaccesstokenop.py index 7d841693..90c01836 100644 --- a/src/clerk_backend_api/models/getoauthaccesstokenop.py +++ b/src/clerk_backend_api/models/getoauthaccesstokenop.py @@ -74,7 +74,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) if val != UNSET_SENTINEL: if val is not None or k not in optional_fields: diff --git a/src/clerk_backend_api/models/getorganizationbillingcreditbalanceop.py b/src/clerk_backend_api/models/getorganizationbillingcreditbalanceop.py new file mode 100644 index 00000000..047c5f8a --- /dev/null +++ b/src/clerk_backend_api/models/getorganizationbillingcreditbalanceop.py @@ -0,0 +1,18 @@ +"""Code generated by Speakeasy (https://speakeasy.com). DO NOT EDIT.""" + +from __future__ import annotations +from clerk_backend_api.types import BaseModel +from clerk_backend_api.utils import FieldMetadata, PathParamMetadata +from typing_extensions import Annotated, TypedDict + + +class GetOrganizationBillingCreditBalanceRequestTypedDict(TypedDict): + organization_id: str + r"""The ID of the organization whose credit balance to retrieve""" + + +class GetOrganizationBillingCreditBalanceRequest(BaseModel): + organization_id: Annotated[ + str, FieldMetadata(path=PathParamMetadata(style="simple", explode=False)) + ] + r"""The ID of the organization whose credit balance to retrieve""" diff --git a/src/clerk_backend_api/models/getorganizationop.py b/src/clerk_backend_api/models/getorganizationop.py index 89708f86..1c7ba071 100644 --- a/src/clerk_backend_api/models/getorganizationop.py +++ b/src/clerk_backend_api/models/getorganizationop.py @@ -48,7 +48,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) if val != UNSET_SENTINEL: if val is not None or k not in optional_fields: diff --git a/src/clerk_backend_api/models/getpublicinterstitialop.py b/src/clerk_backend_api/models/getpublicinterstitialop.py index bbe1fc01..7946ff2c 100644 --- a/src/clerk_backend_api/models/getpublicinterstitialop.py +++ b/src/clerk_backend_api/models/getpublicinterstitialop.py @@ -92,7 +92,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) if val != UNSET_SENTINEL: if val is not None or k not in optional_fields: diff --git a/src/clerk_backend_api/models/getsessionlistop.py b/src/clerk_backend_api/models/getsessionlistop.py index 7c072fed..623b3439 100644 --- a/src/clerk_backend_api/models/getsessionlistop.py +++ b/src/clerk_backend_api/models/getsessionlistop.py @@ -99,7 +99,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) if val != UNSET_SENTINEL: if val is not None or k not in optional_fields: diff --git a/src/clerk_backend_api/models/gettemplatelistop.py b/src/clerk_backend_api/models/gettemplatelistop.py index 22b0b526..876917c8 100644 --- a/src/clerk_backend_api/models/gettemplatelistop.py +++ b/src/clerk_backend_api/models/gettemplatelistop.py @@ -76,7 +76,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) if val != UNSET_SENTINEL: if val is not None or k not in optional_fields: diff --git a/src/clerk_backend_api/models/getuserbillingcreditbalanceop.py b/src/clerk_backend_api/models/getuserbillingcreditbalanceop.py new file mode 100644 index 00000000..61868473 --- /dev/null +++ b/src/clerk_backend_api/models/getuserbillingcreditbalanceop.py @@ -0,0 +1,18 @@ +"""Code generated by Speakeasy (https://speakeasy.com). DO NOT EDIT.""" + +from __future__ import annotations +from clerk_backend_api.types import BaseModel +from clerk_backend_api.utils import FieldMetadata, PathParamMetadata +from typing_extensions import Annotated, TypedDict + + +class GetUserBillingCreditBalanceRequestTypedDict(TypedDict): + user_id: str + r"""The ID of the user whose credit balance to retrieve""" + + +class GetUserBillingCreditBalanceRequest(BaseModel): + user_id: Annotated[ + str, FieldMetadata(path=PathParamMetadata(style="simple", explode=False)) + ] + r"""The ID of the user whose credit balance to retrieve""" diff --git a/src/clerk_backend_api/models/getuserlistop.py b/src/clerk_backend_api/models/getuserlistop.py index b8e5330a..2b0d0415 100644 --- a/src/clerk_backend_api/models/getuserlistop.py +++ b/src/clerk_backend_api/models/getuserlistop.py @@ -404,7 +404,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) if val != UNSET_SENTINEL: if val is not None or k not in optional_fields: diff --git a/src/clerk_backend_api/models/getuserscountop.py b/src/clerk_backend_api/models/getuserscountop.py index 5d3f9cbb..7f6697d6 100644 --- a/src/clerk_backend_api/models/getuserscountop.py +++ b/src/clerk_backend_api/models/getuserscountop.py @@ -339,7 +339,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) if val != UNSET_SENTINEL: if val is not None or k not in optional_fields: diff --git a/src/clerk_backend_api/models/instance.py b/src/clerk_backend_api/models/instance.py index ca9f4776..4da77064 100644 --- a/src/clerk_backend_api/models/instance.py +++ b/src/clerk_backend_api/models/instance.py @@ -43,7 +43,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) if val != UNSET_SENTINEL: m[k] = val diff --git a/src/clerk_backend_api/models/instancegetorganizationmembershipsop.py b/src/clerk_backend_api/models/instancegetorganizationmembershipsop.py index 348c617e..550fe3d2 100644 --- a/src/clerk_backend_api/models/instancegetorganizationmembershipsop.py +++ b/src/clerk_backend_api/models/instancegetorganizationmembershipsop.py @@ -60,7 +60,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) if val != UNSET_SENTINEL: if val is not None or k not in optional_fields: diff --git a/src/clerk_backend_api/models/instancesettings.py b/src/clerk_backend_api/models/instancesettings.py index 17df4caf..58011ea9 100644 --- a/src/clerk_backend_api/models/instancesettings.py +++ b/src/clerk_backend_api/models/instancesettings.py @@ -59,7 +59,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) if val != UNSET_SENTINEL: if val is not None or k not in optional_fields: diff --git a/src/clerk_backend_api/models/invitation.py b/src/clerk_backend_api/models/invitation.py index fce61985..82d0870b 100644 --- a/src/clerk_backend_api/models/invitation.py +++ b/src/clerk_backend_api/models/invitation.py @@ -90,7 +90,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member diff --git a/src/clerk_backend_api/models/invitation_revoked.py b/src/clerk_backend_api/models/invitation_revoked.py index de7e1b09..8bf1cdfe 100644 --- a/src/clerk_backend_api/models/invitation_revoked.py +++ b/src/clerk_backend_api/models/invitation_revoked.py @@ -87,7 +87,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member diff --git a/src/clerk_backend_api/models/invitewaitlistentryop.py b/src/clerk_backend_api/models/invitewaitlistentryop.py index 3fe14c1c..adbd32bd 100644 --- a/src/clerk_backend_api/models/invitewaitlistentryop.py +++ b/src/clerk_backend_api/models/invitewaitlistentryop.py @@ -31,7 +31,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member @@ -73,7 +73,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) if val != UNSET_SENTINEL: if val is not None or k not in optional_fields: diff --git a/src/clerk_backend_api/models/jwks.py b/src/clerk_backend_api/models/jwks.py index 6e5a4071..144c8977 100644 --- a/src/clerk_backend_api/models/jwks.py +++ b/src/clerk_backend_api/models/jwks.py @@ -43,7 +43,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) if val != UNSET_SENTINEL: if val is not None or k not in optional_fields: @@ -71,7 +71,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) if val != UNSET_SENTINEL: if val is not None or k not in optional_fields: diff --git a/src/clerk_backend_api/models/listallorganizationdomainsop.py b/src/clerk_backend_api/models/listallorganizationdomainsop.py index 516092ef..8b28daa9 100644 --- a/src/clerk_backend_api/models/listallorganizationdomainsop.py +++ b/src/clerk_backend_api/models/listallorganizationdomainsop.py @@ -145,7 +145,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) if val != UNSET_SENTINEL: if val is not None or k not in optional_fields: diff --git a/src/clerk_backend_api/models/listallowlistidentifiersop.py b/src/clerk_backend_api/models/listallowlistidentifiersop.py index ee8bb681..6cd11312 100644 --- a/src/clerk_backend_api/models/listallowlistidentifiersop.py +++ b/src/clerk_backend_api/models/listallowlistidentifiersop.py @@ -60,7 +60,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) if val != UNSET_SENTINEL: if val is not None or k not in optional_fields: diff --git a/src/clerk_backend_api/models/listinstanceorganizationinvitationsop.py b/src/clerk_backend_api/models/listinstanceorganizationinvitationsop.py index 921c92e8..6bcb5366 100644 --- a/src/clerk_backend_api/models/listinstanceorganizationinvitationsop.py +++ b/src/clerk_backend_api/models/listinstanceorganizationinvitationsop.py @@ -15,6 +15,7 @@ class ListInstanceOrganizationInvitationsQueryParamStatus(str, Enum): PENDING = "pending" ACCEPTED = "accepted" REVOKED = "revoked" + EXPIRED = "expired" class ListInstanceOrganizationInvitationsRequestTypedDict(TypedDict): @@ -91,7 +92,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) if val != UNSET_SENTINEL: if val is not None or k not in optional_fields: diff --git a/src/clerk_backend_api/models/listinvitationsop.py b/src/clerk_backend_api/models/listinvitationsop.py index c4e6786d..1d51cccf 100644 --- a/src/clerk_backend_api/models/listinvitationsop.py +++ b/src/clerk_backend_api/models/listinvitationsop.py @@ -108,7 +108,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) if val != UNSET_SENTINEL: if val is not None or k not in optional_fields: diff --git a/src/clerk_backend_api/models/listjwttemplatesop.py b/src/clerk_backend_api/models/listjwttemplatesop.py index 71c57a80..ab0711aa 100644 --- a/src/clerk_backend_api/models/listjwttemplatesop.py +++ b/src/clerk_backend_api/models/listjwttemplatesop.py @@ -60,7 +60,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) if val != UNSET_SENTINEL: if val is not None or k not in optional_fields: diff --git a/src/clerk_backend_api/models/listmachinesop.py b/src/clerk_backend_api/models/listmachinesop.py index ce0a3189..0593f8aa 100644 --- a/src/clerk_backend_api/models/listmachinesop.py +++ b/src/clerk_backend_api/models/listmachinesop.py @@ -74,7 +74,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) if val != UNSET_SENTINEL: if val is not None or k not in optional_fields: diff --git a/src/clerk_backend_api/models/listoauthapplicationsop.py b/src/clerk_backend_api/models/listoauthapplicationsop.py index 86ab8f49..2e0a53d0 100644 --- a/src/clerk_backend_api/models/listoauthapplicationsop.py +++ b/src/clerk_backend_api/models/listoauthapplicationsop.py @@ -74,7 +74,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) if val != UNSET_SENTINEL: if val is not None or k not in optional_fields: diff --git a/src/clerk_backend_api/models/listorganizationdomainsop.py b/src/clerk_backend_api/models/listorganizationdomainsop.py index 74aec04d..620c8bf3 100644 --- a/src/clerk_backend_api/models/listorganizationdomainsop.py +++ b/src/clerk_backend_api/models/listorganizationdomainsop.py @@ -69,7 +69,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) if val != UNSET_SENTINEL: if val is not None or k not in optional_fields: diff --git a/src/clerk_backend_api/models/listorganizationinvitationsop.py b/src/clerk_backend_api/models/listorganizationinvitationsop.py index 2ac1a0f9..da50becd 100644 --- a/src/clerk_backend_api/models/listorganizationinvitationsop.py +++ b/src/clerk_backend_api/models/listorganizationinvitationsop.py @@ -15,6 +15,7 @@ class ListOrganizationInvitationsQueryParamStatus(str, Enum): PENDING = "pending" ACCEPTED = "accepted" REVOKED = "revoked" + EXPIRED = "expired" class ListOrganizationInvitationsRequestTypedDict(TypedDict): @@ -100,7 +101,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) if val != UNSET_SENTINEL: if val is not None or k not in optional_fields: diff --git a/src/clerk_backend_api/models/listorganizationmembershipsop.py b/src/clerk_backend_api/models/listorganizationmembershipsop.py index 216a09f9..58b54933 100644 --- a/src/clerk_backend_api/models/listorganizationmembershipsop.py +++ b/src/clerk_backend_api/models/listorganizationmembershipsop.py @@ -258,7 +258,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) if val != UNSET_SENTINEL: if val is not None or k not in optional_fields: diff --git a/src/clerk_backend_api/models/listorganizationpermissionsop.py b/src/clerk_backend_api/models/listorganizationpermissionsop.py index 8dc919ec..06441ee8 100644 --- a/src/clerk_backend_api/models/listorganizationpermissionsop.py +++ b/src/clerk_backend_api/models/listorganizationpermissionsop.py @@ -74,7 +74,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) if val != UNSET_SENTINEL: if val is not None or k not in optional_fields: diff --git a/src/clerk_backend_api/models/listorganizationrolesop.py b/src/clerk_backend_api/models/listorganizationrolesop.py index 73d80962..70c94257 100644 --- a/src/clerk_backend_api/models/listorganizationrolesop.py +++ b/src/clerk_backend_api/models/listorganizationrolesop.py @@ -78,7 +78,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) if val != UNSET_SENTINEL: if val is not None or k not in optional_fields: diff --git a/src/clerk_backend_api/models/listorganizationsop.py b/src/clerk_backend_api/models/listorganizationsop.py index 2d5518a4..11881275 100644 --- a/src/clerk_backend_api/models/listorganizationsop.py +++ b/src/clerk_backend_api/models/listorganizationsop.py @@ -135,7 +135,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) if val != UNSET_SENTINEL: if val is not None or k not in optional_fields: diff --git a/src/clerk_backend_api/models/listpendingorganizationinvitationsop.py b/src/clerk_backend_api/models/listpendingorganizationinvitationsop.py index e72d6b5b..34ae64f3 100644 --- a/src/clerk_backend_api/models/listpendingorganizationinvitationsop.py +++ b/src/clerk_backend_api/models/listpendingorganizationinvitationsop.py @@ -53,7 +53,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) if val != UNSET_SENTINEL: if val is not None or k not in optional_fields: diff --git a/src/clerk_backend_api/models/listredirecturlsop.py b/src/clerk_backend_api/models/listredirecturlsop.py index feff6069..2ed8515d 100644 --- a/src/clerk_backend_api/models/listredirecturlsop.py +++ b/src/clerk_backend_api/models/listredirecturlsop.py @@ -60,7 +60,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) if val != UNSET_SENTINEL: if val is not None or k not in optional_fields: diff --git a/src/clerk_backend_api/models/listrolesetsop.py b/src/clerk_backend_api/models/listrolesetsop.py index 2911be6b..2e28410a 100644 --- a/src/clerk_backend_api/models/listrolesetsop.py +++ b/src/clerk_backend_api/models/listrolesetsop.py @@ -78,7 +78,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) if val != UNSET_SENTINEL: if val is not None or k not in optional_fields: diff --git a/src/clerk_backend_api/models/listsamlconnectionsop.py b/src/clerk_backend_api/models/listsamlconnectionsop.py index efdbc3c1..4fc21d32 100644 --- a/src/clerk_backend_api/models/listsamlconnectionsop.py +++ b/src/clerk_backend_api/models/listsamlconnectionsop.py @@ -92,7 +92,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) if val != UNSET_SENTINEL: if val is not None or k not in optional_fields: diff --git a/src/clerk_backend_api/models/listwaitlistentriesop.py b/src/clerk_backend_api/models/listwaitlistentriesop.py index 9f338f94..7cf372f1 100644 --- a/src/clerk_backend_api/models/listwaitlistentriesop.py +++ b/src/clerk_backend_api/models/listwaitlistentriesop.py @@ -92,7 +92,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) if val != UNSET_SENTINEL: if val is not None or k not in optional_fields: diff --git a/src/clerk_backend_api/models/machine.py b/src/clerk_backend_api/models/machine.py index ecc64c8f..0dd43334 100644 --- a/src/clerk_backend_api/models/machine.py +++ b/src/clerk_backend_api/models/machine.py @@ -66,7 +66,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) if val != UNSET_SENTINEL: if val is not None or k not in optional_fields: diff --git a/src/clerk_backend_api/models/machine_created.py b/src/clerk_backend_api/models/machine_created.py index c0c0ad8e..3d519143 100644 --- a/src/clerk_backend_api/models/machine_created.py +++ b/src/clerk_backend_api/models/machine_created.py @@ -75,7 +75,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) if val != UNSET_SENTINEL: if val is not None or k not in optional_fields: diff --git a/src/clerk_backend_api/models/machinewithoutscopedmachines.py b/src/clerk_backend_api/models/machinewithoutscopedmachines.py index d409a13d..124160bb 100644 --- a/src/clerk_backend_api/models/machinewithoutscopedmachines.py +++ b/src/clerk_backend_api/models/machinewithoutscopedmachines.py @@ -57,7 +57,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) if val != UNSET_SENTINEL: if val is not None or k not in optional_fields: diff --git a/src/clerk_backend_api/models/mergeorganizationmetadataop.py b/src/clerk_backend_api/models/mergeorganizationmetadataop.py index 23d3fef4..264ebbc9 100644 --- a/src/clerk_backend_api/models/mergeorganizationmetadataop.py +++ b/src/clerk_backend_api/models/mergeorganizationmetadataop.py @@ -38,7 +38,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) if val != UNSET_SENTINEL: if val is not None or k not in optional_fields: diff --git a/src/clerk_backend_api/models/oauthaccesstoken.py b/src/clerk_backend_api/models/oauthaccesstoken.py index 69d3f958..1a9801cc 100644 --- a/src/clerk_backend_api/models/oauthaccesstoken.py +++ b/src/clerk_backend_api/models/oauthaccesstoken.py @@ -78,7 +78,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member diff --git a/src/clerk_backend_api/models/oauthapplication.py b/src/clerk_backend_api/models/oauthapplication.py index 99d09327..c899f814 100644 --- a/src/clerk_backend_api/models/oauthapplication.py +++ b/src/clerk_backend_api/models/oauthapplication.py @@ -110,7 +110,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) if val != UNSET_SENTINEL: m[k] = val diff --git a/src/clerk_backend_api/models/oauthapplicationsettings.py b/src/clerk_backend_api/models/oauthapplicationsettings.py new file mode 100644 index 00000000..0110c418 --- /dev/null +++ b/src/clerk_backend_api/models/oauthapplicationsettings.py @@ -0,0 +1,36 @@ +"""Code generated by Speakeasy (https://speakeasy.com). DO NOT EDIT.""" + +from __future__ import annotations +from clerk_backend_api.types import BaseModel +from enum import Enum +from typing_extensions import TypedDict + + +class OAuthApplicationSettingsObject(str, Enum): + r"""String representing the object's type. Objects of the same type share the same value.""" + + OAUTH_APPLICATION_SETTINGS = "oauth_application_settings" + + +class OAuthApplicationSettingsTypedDict(TypedDict): + r"""Success""" + + object: OAuthApplicationSettingsObject + r"""String representing the object's type. Objects of the same type share the same value.""" + dynamic_oauth_client_registration: bool + r"""Whether dynamic OAuth client registration is enabled for the instance (RFC 7591).""" + oauth_jwt_access_tokens: bool + r"""Whether OAuth JWT access tokens are enabled for the instance (disabled indicates opaque access tokens).""" + + +class OAuthApplicationSettings(BaseModel): + r"""Success""" + + object: OAuthApplicationSettingsObject + r"""String representing the object's type. Objects of the same type share the same value.""" + + dynamic_oauth_client_registration: bool + r"""Whether dynamic OAuth client registration is enabled for the instance (RFC 7591).""" + + oauth_jwt_access_tokens: bool + r"""Whether OAuth JWT access tokens are enabled for the instance (disabled indicates opaque access tokens).""" diff --git a/src/clerk_backend_api/models/oauthapplicationwithsecret.py b/src/clerk_backend_api/models/oauthapplicationwithsecret.py index 6b9d38ce..5d7c9a28 100644 --- a/src/clerk_backend_api/models/oauthapplicationwithsecret.py +++ b/src/clerk_backend_api/models/oauthapplicationwithsecret.py @@ -121,7 +121,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member diff --git a/src/clerk_backend_api/models/organization.py b/src/clerk_backend_api/models/organization.py index 0df8acd5..e14ddfc9 100644 --- a/src/clerk_backend_api/models/organization.py +++ b/src/clerk_backend_api/models/organization.py @@ -120,7 +120,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member diff --git a/src/clerk_backend_api/models/organizationdomain.py b/src/clerk_backend_api/models/organizationdomain.py index e5a85b23..32ed0f3f 100644 --- a/src/clerk_backend_api/models/organizationdomain.py +++ b/src/clerk_backend_api/models/organizationdomain.py @@ -70,7 +70,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) if val != UNSET_SENTINEL: m[k] = val @@ -109,7 +109,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) if val != UNSET_SENTINEL: if val is not None or k not in optional_fields: @@ -201,7 +201,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member diff --git a/src/clerk_backend_api/models/organizationinvitation.py b/src/clerk_backend_api/models/organizationinvitation.py index bb562787..0fd583f6 100644 --- a/src/clerk_backend_api/models/organizationinvitation.py +++ b/src/clerk_backend_api/models/organizationinvitation.py @@ -96,7 +96,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member diff --git a/src/clerk_backend_api/models/organizationinvitationpublicorganizationdata.py b/src/clerk_backend_api/models/organizationinvitationpublicorganizationdata.py index 14174a92..b6e906c3 100644 --- a/src/clerk_backend_api/models/organizationinvitationpublicorganizationdata.py +++ b/src/clerk_backend_api/models/organizationinvitationpublicorganizationdata.py @@ -34,7 +34,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) if val != UNSET_SENTINEL: if val is not None or k not in optional_fields: diff --git a/src/clerk_backend_api/models/organizationinvitationpublicuserdata.py b/src/clerk_backend_api/models/organizationinvitationpublicuserdata.py index 1bcc9a7a..37c438f1 100644 --- a/src/clerk_backend_api/models/organizationinvitationpublicuserdata.py +++ b/src/clerk_backend_api/models/organizationinvitationpublicuserdata.py @@ -39,7 +39,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) if val != UNSET_SENTINEL: m[k] = val diff --git a/src/clerk_backend_api/models/organizationinvitationwithpublicorganizationdata.py b/src/clerk_backend_api/models/organizationinvitationwithpublicorganizationdata.py index 8b5b670b..a79eab9b 100644 --- a/src/clerk_backend_api/models/organizationinvitationwithpublicorganizationdata.py +++ b/src/clerk_backend_api/models/organizationinvitationwithpublicorganizationdata.py @@ -114,7 +114,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member diff --git a/src/clerk_backend_api/models/organizationmembership.py b/src/clerk_backend_api/models/organizationmembership.py index f38296fc..fb125573 100644 --- a/src/clerk_backend_api/models/organizationmembership.py +++ b/src/clerk_backend_api/models/organizationmembership.py @@ -130,7 +130,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member @@ -213,7 +213,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member diff --git a/src/clerk_backend_api/models/organizationmembershippublicuserdata.py b/src/clerk_backend_api/models/organizationmembershippublicuserdata.py index 61ec55d0..2107e2ac 100644 --- a/src/clerk_backend_api/models/organizationmembershippublicuserdata.py +++ b/src/clerk_backend_api/models/organizationmembershippublicuserdata.py @@ -61,7 +61,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member diff --git a/src/clerk_backend_api/models/organizationsettings.py b/src/clerk_backend_api/models/organizationsettings.py index fcc57344..8c0db9cf 100644 --- a/src/clerk_backend_api/models/organizationsettings.py +++ b/src/clerk_backend_api/models/organizationsettings.py @@ -107,7 +107,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member diff --git a/src/clerk_backend_api/models/organizationwithlogo.py b/src/clerk_backend_api/models/organizationwithlogo.py index ce8c0856..4d407070 100644 --- a/src/clerk_backend_api/models/organizationwithlogo.py +++ b/src/clerk_backend_api/models/organizationwithlogo.py @@ -129,7 +129,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member diff --git a/src/clerk_backend_api/models/passkey.py b/src/clerk_backend_api/models/passkey.py index e5e379fc..57bcba26 100644 --- a/src/clerk_backend_api/models/passkey.py +++ b/src/clerk_backend_api/models/passkey.py @@ -75,7 +75,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member @@ -138,7 +138,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member diff --git a/src/clerk_backend_api/models/phonenumber.py b/src/clerk_backend_api/models/phonenumber.py index 775ecbba..499dcd63 100644 --- a/src/clerk_backend_api/models/phonenumber.py +++ b/src/clerk_backend_api/models/phonenumber.py @@ -75,7 +75,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member @@ -149,7 +149,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member @@ -256,7 +256,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member diff --git a/src/clerk_backend_api/models/previewtemplateop.py b/src/clerk_backend_api/models/previewtemplateop.py index 1b390881..186e6b0b 100644 --- a/src/clerk_backend_api/models/previewtemplateop.py +++ b/src/clerk_backend_api/models/previewtemplateop.py @@ -69,7 +69,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member @@ -120,7 +120,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) if val != UNSET_SENTINEL: if val is not None or k not in optional_fields: diff --git a/src/clerk_backend_api/models/proxycheck.py b/src/clerk_backend_api/models/proxycheck.py index 22d2634a..110aab8d 100644 --- a/src/clerk_backend_api/models/proxycheck.py +++ b/src/clerk_backend_api/models/proxycheck.py @@ -68,7 +68,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) if val != UNSET_SENTINEL: m[k] = val diff --git a/src/clerk_backend_api/models/refreshsessionop.py b/src/clerk_backend_api/models/refreshsessionop.py index 5a5ed043..46f71f6e 100644 --- a/src/clerk_backend_api/models/refreshsessionop.py +++ b/src/clerk_backend_api/models/refreshsessionop.py @@ -76,7 +76,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member @@ -120,7 +120,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) if val != UNSET_SENTINEL: if val is not None or k not in optional_fields: diff --git a/src/clerk_backend_api/models/replacerolesetop.py b/src/clerk_backend_api/models/replacerolesetop.py index d114cc0f..8da7e8c4 100644 --- a/src/clerk_backend_api/models/replacerolesetop.py +++ b/src/clerk_backend_api/models/replacerolesetop.py @@ -34,7 +34,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) if val != UNSET_SENTINEL: if val is not None or k not in optional_fields: diff --git a/src/clerk_backend_api/models/revokeagenttaskop.py b/src/clerk_backend_api/models/revokeagenttaskop.py new file mode 100644 index 00000000..21487c98 --- /dev/null +++ b/src/clerk_backend_api/models/revokeagenttaskop.py @@ -0,0 +1,18 @@ +"""Code generated by Speakeasy (https://speakeasy.com). DO NOT EDIT.""" + +from __future__ import annotations +from clerk_backend_api.types import BaseModel +from clerk_backend_api.utils import FieldMetadata, PathParamMetadata +from typing_extensions import Annotated, TypedDict + + +class RevokeAgentTaskRequestTypedDict(TypedDict): + agent_task_id: str + r"""The ID of the agent task to be revoked.""" + + +class RevokeAgentTaskRequest(BaseModel): + agent_task_id: Annotated[ + str, FieldMetadata(path=PathParamMetadata(style="simple", explode=False)) + ] + r"""The ID of the agent task to be revoked.""" diff --git a/src/clerk_backend_api/models/revokeapikeyop.py b/src/clerk_backend_api/models/revokeapikeyop.py index 5dbb10df..6b06431b 100644 --- a/src/clerk_backend_api/models/revokeapikeyop.py +++ b/src/clerk_backend_api/models/revokeapikeyop.py @@ -35,7 +35,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member @@ -226,7 +226,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member diff --git a/src/clerk_backend_api/models/revokem2mtokenop.py b/src/clerk_backend_api/models/revokem2mtokenop.py index 8cfbf58c..28ac5ea7 100644 --- a/src/clerk_backend_api/models/revokem2mtokenop.py +++ b/src/clerk_backend_api/models/revokem2mtokenop.py @@ -34,7 +34,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member @@ -204,7 +204,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member diff --git a/src/clerk_backend_api/models/revokeorganizationinvitationop.py b/src/clerk_backend_api/models/revokeorganizationinvitationop.py index 64d6c11a..d858d175 100644 --- a/src/clerk_backend_api/models/revokeorganizationinvitationop.py +++ b/src/clerk_backend_api/models/revokeorganizationinvitationop.py @@ -36,7 +36,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member @@ -85,7 +85,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) if val != UNSET_SENTINEL: if val is not None or k not in optional_fields: diff --git a/src/clerk_backend_api/models/role.py b/src/clerk_backend_api/models/role.py index 254cab2c..a4ae31f5 100644 --- a/src/clerk_backend_api/models/role.py +++ b/src/clerk_backend_api/models/role.py @@ -65,7 +65,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) if val != UNSET_SENTINEL: m[k] = val diff --git a/src/clerk_backend_api/models/roleset.py b/src/clerk_backend_api/models/roleset.py index 49dbde03..c6b09d70 100644 --- a/src/clerk_backend_api/models/roleset.py +++ b/src/clerk_backend_api/models/roleset.py @@ -83,7 +83,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member @@ -164,7 +164,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member @@ -293,7 +293,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member @@ -387,7 +387,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member diff --git a/src/clerk_backend_api/models/rolesetitem.py b/src/clerk_backend_api/models/rolesetitem.py index 7f3e8754..242bd7a0 100644 --- a/src/clerk_backend_api/models/rolesetitem.py +++ b/src/clerk_backend_api/models/rolesetitem.py @@ -77,7 +77,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member diff --git a/src/clerk_backend_api/models/samlaccount.py b/src/clerk_backend_api/models/samlaccount.py index bd590c3d..c8a91822 100644 --- a/src/clerk_backend_api/models/samlaccount.py +++ b/src/clerk_backend_api/models/samlaccount.py @@ -79,7 +79,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member @@ -144,7 +144,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) if val != UNSET_SENTINEL: if val is not None or k not in optional_fields: @@ -214,7 +214,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member @@ -318,7 +318,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) if val != UNSET_SENTINEL: if val is not None or k not in optional_fields: @@ -399,7 +399,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) if val != UNSET_SENTINEL: if val is not None or k not in optional_fields: @@ -504,7 +504,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member diff --git a/src/clerk_backend_api/models/schemas_commerceplan.py b/src/clerk_backend_api/models/schemas_commerceplan.py index 153423e2..cf360a12 100644 --- a/src/clerk_backend_api/models/schemas_commerceplan.py +++ b/src/clerk_backend_api/models/schemas_commerceplan.py @@ -179,7 +179,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member diff --git a/src/clerk_backend_api/models/schemas_commercesubscriptionitem.py b/src/clerk_backend_api/models/schemas_commercesubscriptionitem.py index 006a37d2..bf4b219a 100644 --- a/src/clerk_backend_api/models/schemas_commercesubscriptionitem.py +++ b/src/clerk_backend_api/models/schemas_commercesubscriptionitem.py @@ -93,7 +93,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member @@ -274,7 +274,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member @@ -431,7 +431,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member @@ -564,7 +564,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member @@ -639,7 +639,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member @@ -743,7 +743,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) if val != UNSET_SENTINEL: if val is not None or k not in optional_fields: @@ -933,7 +933,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member diff --git a/src/clerk_backend_api/models/schemas_samlconnection.py b/src/clerk_backend_api/models/schemas_samlconnection.py index 9c4e1b3f..af1015ff 100644 --- a/src/clerk_backend_api/models/schemas_samlconnection.py +++ b/src/clerk_backend_api/models/schemas_samlconnection.py @@ -152,7 +152,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member @@ -302,7 +302,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member diff --git a/src/clerk_backend_api/models/security.py b/src/clerk_backend_api/models/security.py index fc2d014c..e726c975 100644 --- a/src/clerk_backend_api/models/security.py +++ b/src/clerk_backend_api/models/security.py @@ -33,7 +33,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) if val != UNSET_SENTINEL: if val is not None or k not in optional_fields: diff --git a/src/clerk_backend_api/models/session.py b/src/clerk_backend_api/models/session.py index 3f6cc39a..eae7aaec 100644 --- a/src/clerk_backend_api/models/session.py +++ b/src/clerk_backend_api/models/session.py @@ -133,7 +133,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member diff --git a/src/clerk_backend_api/models/sessionactivityresponse.py b/src/clerk_backend_api/models/sessionactivityresponse.py index 46833ff7..1687f2b4 100644 --- a/src/clerk_backend_api/models/sessionactivityresponse.py +++ b/src/clerk_backend_api/models/sessionactivityresponse.py @@ -55,7 +55,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) if val != UNSET_SENTINEL: if val is not None or k not in optional_fields: diff --git a/src/clerk_backend_api/models/setuserpasswordcompromisedop.py b/src/clerk_backend_api/models/setuserpasswordcompromisedop.py index 3eb632d4..9e2391ff 100644 --- a/src/clerk_backend_api/models/setuserpasswordcompromisedop.py +++ b/src/clerk_backend_api/models/setuserpasswordcompromisedop.py @@ -30,7 +30,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member @@ -72,7 +72,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) if val != UNSET_SENTINEL: if val is not None or k not in optional_fields: diff --git a/src/clerk_backend_api/models/setuserprofileimageop.py b/src/clerk_backend_api/models/setuserprofileimageop.py index 30e02493..cca96e4a 100644 --- a/src/clerk_backend_api/models/setuserprofileimageop.py +++ b/src/clerk_backend_api/models/setuserprofileimageop.py @@ -46,7 +46,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) if val != UNSET_SENTINEL: if val is not None or k not in optional_fields: @@ -72,7 +72,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) if val != UNSET_SENTINEL: if val is not None or k not in optional_fields: diff --git a/src/clerk_backend_api/models/signintoken.py b/src/clerk_backend_api/models/signintoken.py index 657cb69c..f8d1872d 100644 --- a/src/clerk_backend_api/models/signintoken.py +++ b/src/clerk_backend_api/models/signintoken.py @@ -77,7 +77,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member diff --git a/src/clerk_backend_api/models/signup.py b/src/clerk_backend_api/models/signup.py index e5e3485c..1e89244a 100644 --- a/src/clerk_backend_api/models/signup.py +++ b/src/clerk_backend_api/models/signup.py @@ -167,7 +167,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member diff --git a/src/clerk_backend_api/models/signupverification.py b/src/clerk_backend_api/models/signupverification.py index 31c36a8e..c475c711 100644 --- a/src/clerk_backend_api/models/signupverification.py +++ b/src/clerk_backend_api/models/signupverification.py @@ -46,8 +46,8 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) - serialized.pop(k, None) + val = serialized.get(k, serialized.get(n)) + serialized.pop(k, serialized.pop(n, None)) if val != UNSET_SENTINEL: if val is not None or k not in optional_fields: diff --git a/src/clerk_backend_api/models/signupverifications.py b/src/clerk_backend_api/models/signupverifications.py index fa578bf2..01d2eb51 100644 --- a/src/clerk_backend_api/models/signupverifications.py +++ b/src/clerk_backend_api/models/signupverifications.py @@ -38,7 +38,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) if val != UNSET_SENTINEL: m[k] = val diff --git a/src/clerk_backend_api/models/template.py b/src/clerk_backend_api/models/template.py index e31a293d..c12c7896 100644 --- a/src/clerk_backend_api/models/template.py +++ b/src/clerk_backend_api/models/template.py @@ -184,7 +184,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member diff --git a/src/clerk_backend_api/models/toggletemplatedeliveryop.py b/src/clerk_backend_api/models/toggletemplatedeliveryop.py index 46b71769..03b41233 100644 --- a/src/clerk_backend_api/models/toggletemplatedeliveryop.py +++ b/src/clerk_backend_api/models/toggletemplatedeliveryop.py @@ -33,7 +33,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) if val != UNSET_SENTINEL: if val is not None or k not in optional_fields: @@ -75,7 +75,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) if val != UNSET_SENTINEL: if val is not None or k not in optional_fields: diff --git a/src/clerk_backend_api/models/updateapikeyop.py b/src/clerk_backend_api/models/updateapikeyop.py index 36d8c05c..49ec65b5 100644 --- a/src/clerk_backend_api/models/updateapikeyop.py +++ b/src/clerk_backend_api/models/updateapikeyop.py @@ -49,7 +49,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member @@ -240,7 +240,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member diff --git a/src/clerk_backend_api/models/updatedomainop.py b/src/clerk_backend_api/models/updatedomainop.py index 5461eff3..039c3115 100644 --- a/src/clerk_backend_api/models/updatedomainop.py +++ b/src/clerk_backend_api/models/updatedomainop.py @@ -57,7 +57,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member diff --git a/src/clerk_backend_api/models/updateemailaddressop.py b/src/clerk_backend_api/models/updateemailaddressop.py index 72b76f23..595dedce 100644 --- a/src/clerk_backend_api/models/updateemailaddressop.py +++ b/src/clerk_backend_api/models/updateemailaddressop.py @@ -37,7 +37,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member @@ -79,7 +79,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) if val != UNSET_SENTINEL: if val is not None or k not in optional_fields: diff --git a/src/clerk_backend_api/models/updateinstanceauthconfigop.py b/src/clerk_backend_api/models/updateinstanceauthconfigop.py index 5c82ef40..4b96ae06 100644 --- a/src/clerk_backend_api/models/updateinstanceauthconfigop.py +++ b/src/clerk_backend_api/models/updateinstanceauthconfigop.py @@ -69,7 +69,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member diff --git a/src/clerk_backend_api/models/updateinstanceoauthapplicationsettingsop.py b/src/clerk_backend_api/models/updateinstanceoauthapplicationsettingsop.py new file mode 100644 index 00000000..516e7527 --- /dev/null +++ b/src/clerk_backend_api/models/updateinstanceoauthapplicationsettingsop.py @@ -0,0 +1,56 @@ +"""Code generated by Speakeasy (https://speakeasy.com). DO NOT EDIT.""" + +from __future__ import annotations +from clerk_backend_api.types import ( + BaseModel, + Nullable, + OptionalNullable, + UNSET, + UNSET_SENTINEL, +) +from pydantic import model_serializer +from typing_extensions import NotRequired, TypedDict + + +class UpdateInstanceOAuthApplicationSettingsRequestBodyTypedDict(TypedDict): + dynamic_oauth_client_registration: NotRequired[Nullable[bool]] + r"""Whether dynamic OAuth client registration is enabled for the instance (RFC 7591).""" + oauth_jwt_access_tokens: NotRequired[Nullable[bool]] + r"""Whether OAuth JWT access tokens are enabled for the instance (disabled indicates opaque access tokens).""" + + +class UpdateInstanceOAuthApplicationSettingsRequestBody(BaseModel): + dynamic_oauth_client_registration: OptionalNullable[bool] = UNSET + r"""Whether dynamic OAuth client registration is enabled for the instance (RFC 7591).""" + + oauth_jwt_access_tokens: OptionalNullable[bool] = UNSET + r"""Whether OAuth JWT access tokens are enabled for the instance (disabled indicates opaque access tokens).""" + + @model_serializer(mode="wrap") + def serialize_model(self, handler): + optional_fields = set( + ["dynamic_oauth_client_registration", "oauth_jwt_access_tokens"] + ) + nullable_fields = set( + ["dynamic_oauth_client_registration", "oauth_jwt_access_tokens"] + ) + serialized = handler(self) + m = {} + + for n, f in type(self).model_fields.items(): + k = f.alias or n + val = serialized.get(k, serialized.get(n)) + is_nullable_and_explicitly_set = ( + k in nullable_fields + and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member + ) + + if val != UNSET_SENTINEL: + if ( + val is not None + or k not in optional_fields + or is_nullable_and_explicitly_set + ): + m[k] = val + + return m diff --git a/src/clerk_backend_api/models/updateinstanceop.py b/src/clerk_backend_api/models/updateinstanceop.py index 81a9dbe0..cd08a835 100644 --- a/src/clerk_backend_api/models/updateinstanceop.py +++ b/src/clerk_backend_api/models/updateinstanceop.py @@ -95,7 +95,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member diff --git a/src/clerk_backend_api/models/updateinstanceorganizationsettingsop.py b/src/clerk_backend_api/models/updateinstanceorganizationsettingsop.py index 6a838b78..d91b2d61 100644 --- a/src/clerk_backend_api/models/updateinstanceorganizationsettingsop.py +++ b/src/clerk_backend_api/models/updateinstanceorganizationsettingsop.py @@ -81,7 +81,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member diff --git a/src/clerk_backend_api/models/updateinstanceprotectop.py b/src/clerk_backend_api/models/updateinstanceprotectop.py index fbef8386..3ab7addf 100644 --- a/src/clerk_backend_api/models/updateinstanceprotectop.py +++ b/src/clerk_backend_api/models/updateinstanceprotectop.py @@ -31,7 +31,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member diff --git a/src/clerk_backend_api/models/updateinstancerestrictionsop.py b/src/clerk_backend_api/models/updateinstancerestrictionsop.py index 656ee66b..dd7688a6 100644 --- a/src/clerk_backend_api/models/updateinstancerestrictionsop.py +++ b/src/clerk_backend_api/models/updateinstancerestrictionsop.py @@ -56,7 +56,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member diff --git a/src/clerk_backend_api/models/updatejwttemplateop.py b/src/clerk_backend_api/models/updatejwttemplateop.py index 0d91d0c5..cd8c0f7d 100644 --- a/src/clerk_backend_api/models/updatejwttemplateop.py +++ b/src/clerk_backend_api/models/updatejwttemplateop.py @@ -80,7 +80,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member @@ -122,7 +122,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) if val != UNSET_SENTINEL: if val is not None or k not in optional_fields: diff --git a/src/clerk_backend_api/models/updatemachineop.py b/src/clerk_backend_api/models/updatemachineop.py index a92c575b..b1b964b0 100644 --- a/src/clerk_backend_api/models/updatemachineop.py +++ b/src/clerk_backend_api/models/updatemachineop.py @@ -30,7 +30,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) if val != UNSET_SENTINEL: if val is not None or k not in optional_fields: @@ -64,7 +64,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) if val != UNSET_SENTINEL: if val is not None or k not in optional_fields: diff --git a/src/clerk_backend_api/models/updateoauthapplicationop.py b/src/clerk_backend_api/models/updateoauthapplicationop.py index 0419fb4a..4775edcd 100644 --- a/src/clerk_backend_api/models/updateoauthapplicationop.py +++ b/src/clerk_backend_api/models/updateoauthapplicationop.py @@ -92,7 +92,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member diff --git a/src/clerk_backend_api/models/updateorganizationdomainop.py b/src/clerk_backend_api/models/updateorganizationdomainop.py index 8ba026e9..44b6a62a 100644 --- a/src/clerk_backend_api/models/updateorganizationdomainop.py +++ b/src/clerk_backend_api/models/updateorganizationdomainop.py @@ -36,7 +36,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member diff --git a/src/clerk_backend_api/models/updateorganizationmembershipmetadataop.py b/src/clerk_backend_api/models/updateorganizationmembershipmetadataop.py index 488a0950..d6bfdc97 100644 --- a/src/clerk_backend_api/models/updateorganizationmembershipmetadataop.py +++ b/src/clerk_backend_api/models/updateorganizationmembershipmetadataop.py @@ -38,7 +38,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) if val != UNSET_SENTINEL: if val is not None or k not in optional_fields: @@ -79,7 +79,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) if val != UNSET_SENTINEL: if val is not None or k not in optional_fields: diff --git a/src/clerk_backend_api/models/updateorganizationop.py b/src/clerk_backend_api/models/updateorganizationop.py index b0046ae8..ace77af3 100644 --- a/src/clerk_backend_api/models/updateorganizationop.py +++ b/src/clerk_backend_api/models/updateorganizationop.py @@ -95,7 +95,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member diff --git a/src/clerk_backend_api/models/updateorganizationpermissionop.py b/src/clerk_backend_api/models/updateorganizationpermissionop.py index 21e47878..25f5c0ce 100644 --- a/src/clerk_backend_api/models/updateorganizationpermissionop.py +++ b/src/clerk_backend_api/models/updateorganizationpermissionop.py @@ -35,7 +35,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) if val != UNSET_SENTINEL: if val is not None or k not in optional_fields: diff --git a/src/clerk_backend_api/models/updateorganizationroleop.py b/src/clerk_backend_api/models/updateorganizationroleop.py index cfabaa08..23c1b064 100644 --- a/src/clerk_backend_api/models/updateorganizationroleop.py +++ b/src/clerk_backend_api/models/updateorganizationroleop.py @@ -47,7 +47,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member diff --git a/src/clerk_backend_api/models/updatephonenumberop.py b/src/clerk_backend_api/models/updatephonenumberop.py index 89ba0eaa..456fb5cb 100644 --- a/src/clerk_backend_api/models/updatephonenumberop.py +++ b/src/clerk_backend_api/models/updatephonenumberop.py @@ -48,7 +48,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member @@ -90,7 +90,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) if val != UNSET_SENTINEL: if val is not None or k not in optional_fields: diff --git a/src/clerk_backend_api/models/updateproductioninstancedomainop.py b/src/clerk_backend_api/models/updateproductioninstancedomainop.py index ca60067e..a8b9ed28 100644 --- a/src/clerk_backend_api/models/updateproductioninstancedomainop.py +++ b/src/clerk_backend_api/models/updateproductioninstancedomainop.py @@ -29,7 +29,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) if val != UNSET_SENTINEL: if val is not None or k not in optional_fields: diff --git a/src/clerk_backend_api/models/updaterolesetop.py b/src/clerk_backend_api/models/updaterolesetop.py index 3c563840..d947e910 100644 --- a/src/clerk_backend_api/models/updaterolesetop.py +++ b/src/clerk_backend_api/models/updaterolesetop.py @@ -95,7 +95,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member diff --git a/src/clerk_backend_api/models/updatesamlconnectionop.py b/src/clerk_backend_api/models/updatesamlconnectionop.py index 80624761..87abc42e 100644 --- a/src/clerk_backend_api/models/updatesamlconnectionop.py +++ b/src/clerk_backend_api/models/updatesamlconnectionop.py @@ -43,7 +43,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) if val != UNSET_SENTINEL: if val is not None or k not in optional_fields: @@ -194,7 +194,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member diff --git a/src/clerk_backend_api/models/updatesignupop.py b/src/clerk_backend_api/models/updatesignupop.py index 957d5aa6..6615769f 100644 --- a/src/clerk_backend_api/models/updatesignupop.py +++ b/src/clerk_backend_api/models/updatesignupop.py @@ -41,7 +41,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member @@ -83,7 +83,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) if val != UNSET_SENTINEL: if val is not None or k not in optional_fields: diff --git a/src/clerk_backend_api/models/updateusermetadataop.py b/src/clerk_backend_api/models/updateusermetadataop.py index 789a90a8..5472bee7 100644 --- a/src/clerk_backend_api/models/updateusermetadataop.py +++ b/src/clerk_backend_api/models/updateusermetadataop.py @@ -53,7 +53,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) if val != UNSET_SENTINEL: if val is not None or k not in optional_fields: @@ -87,7 +87,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) if val != UNSET_SENTINEL: if val is not None or k not in optional_fields: diff --git a/src/clerk_backend_api/models/updateuserop.py b/src/clerk_backend_api/models/updateuserop.py index e6e96fb7..6f606215 100644 --- a/src/clerk_backend_api/models/updateuserop.py +++ b/src/clerk_backend_api/models/updateuserop.py @@ -291,7 +291,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member diff --git a/src/clerk_backend_api/models/uploadorganizationlogoop.py b/src/clerk_backend_api/models/uploadorganizationlogoop.py index 48415c8d..0b6a720f 100644 --- a/src/clerk_backend_api/models/uploadorganizationlogoop.py +++ b/src/clerk_backend_api/models/uploadorganizationlogoop.py @@ -46,7 +46,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) if val != UNSET_SENTINEL: if val is not None or k not in optional_fields: @@ -78,7 +78,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) if val != UNSET_SENTINEL: if val is not None or k not in optional_fields: @@ -112,7 +112,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) if val != UNSET_SENTINEL: if val is not None or k not in optional_fields: diff --git a/src/clerk_backend_api/models/upserttemplateop.py b/src/clerk_backend_api/models/upserttemplateop.py index f4497c78..ef8a1b43 100644 --- a/src/clerk_backend_api/models/upserttemplateop.py +++ b/src/clerk_backend_api/models/upserttemplateop.py @@ -96,7 +96,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member @@ -146,7 +146,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) if val != UNSET_SENTINEL: if val is not None or k not in optional_fields: diff --git a/src/clerk_backend_api/models/user.py b/src/clerk_backend_api/models/user.py index 55f468b8..87cad551 100644 --- a/src/clerk_backend_api/models/user.py +++ b/src/clerk_backend_api/models/user.py @@ -320,7 +320,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member diff --git a/src/clerk_backend_api/models/usersgetorganizationinvitationsop.py b/src/clerk_backend_api/models/usersgetorganizationinvitationsop.py index ecdf9979..6b7ac01f 100644 --- a/src/clerk_backend_api/models/usersgetorganizationinvitationsop.py +++ b/src/clerk_backend_api/models/usersgetorganizationinvitationsop.py @@ -15,6 +15,7 @@ class UsersGetOrganizationInvitationsQueryParamStatus(str, Enum): PENDING = "pending" ACCEPTED = "accepted" REVOKED = "revoked" + EXPIRED = "expired" class UsersGetOrganizationInvitationsRequestTypedDict(TypedDict): @@ -70,7 +71,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) if val != UNSET_SENTINEL: if val is not None or k not in optional_fields: diff --git a/src/clerk_backend_api/models/usersgetorganizationmembershipsop.py b/src/clerk_backend_api/models/usersgetorganizationmembershipsop.py index 38d4f67e..dbc7d5f9 100644 --- a/src/clerk_backend_api/models/usersgetorganizationmembershipsop.py +++ b/src/clerk_backend_api/models/usersgetorganizationmembershipsop.py @@ -53,7 +53,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) if val != UNSET_SENTINEL: if val is not None or k not in optional_fields: diff --git a/src/clerk_backend_api/models/verifyapikeyop.py b/src/clerk_backend_api/models/verifyapikeyop.py index 19165262..9204be32 100644 --- a/src/clerk_backend_api/models/verifyapikeyop.py +++ b/src/clerk_backend_api/models/verifyapikeyop.py @@ -181,7 +181,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member diff --git a/src/clerk_backend_api/models/verifydomainproxyop.py b/src/clerk_backend_api/models/verifydomainproxyop.py index 374a18d6..30309be9 100644 --- a/src/clerk_backend_api/models/verifydomainproxyop.py +++ b/src/clerk_backend_api/models/verifydomainproxyop.py @@ -29,7 +29,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) if val != UNSET_SENTINEL: if val is not None or k not in optional_fields: diff --git a/src/clerk_backend_api/models/verifym2mtokenop.py b/src/clerk_backend_api/models/verifym2mtokenop.py index 63b2318c..e0ef401c 100644 --- a/src/clerk_backend_api/models/verifym2mtokenop.py +++ b/src/clerk_backend_api/models/verifym2mtokenop.py @@ -162,7 +162,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member diff --git a/src/clerk_backend_api/models/verifyoauthaccesstokenop.py b/src/clerk_backend_api/models/verifyoauthaccesstokenop.py index 09c6059c..3faaae68 100644 --- a/src/clerk_backend_api/models/verifyoauthaccesstokenop.py +++ b/src/clerk_backend_api/models/verifyoauthaccesstokenop.py @@ -39,7 +39,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) if val != UNSET_SENTINEL: if val is not None or k not in optional_fields: @@ -178,7 +178,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) if val != UNSET_SENTINEL: m[k] = val diff --git a/src/clerk_backend_api/models/verifypasswordop.py b/src/clerk_backend_api/models/verifypasswordop.py index 1254eac5..b63e6b2f 100644 --- a/src/clerk_backend_api/models/verifypasswordop.py +++ b/src/clerk_backend_api/models/verifypasswordop.py @@ -43,7 +43,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) if val != UNSET_SENTINEL: if val is not None or k not in optional_fields: @@ -71,7 +71,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) if val != UNSET_SENTINEL: if val is not None or k not in optional_fields: diff --git a/src/clerk_backend_api/models/verifytotpop.py b/src/clerk_backend_api/models/verifytotpop.py index 1fb852b6..b69430ed 100644 --- a/src/clerk_backend_api/models/verifytotpop.py +++ b/src/clerk_backend_api/models/verifytotpop.py @@ -44,7 +44,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) if val != UNSET_SENTINEL: if val is not None or k not in optional_fields: @@ -80,7 +80,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) if val != UNSET_SENTINEL: if val is not None or k not in optional_fields: diff --git a/src/clerk_backend_api/models/waitlistentry.py b/src/clerk_backend_api/models/waitlistentry.py index 5f807a92..81312e5e 100644 --- a/src/clerk_backend_api/models/waitlistentry.py +++ b/src/clerk_backend_api/models/waitlistentry.py @@ -97,7 +97,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member @@ -169,7 +169,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member diff --git a/src/clerk_backend_api/models/web3wallet.py b/src/clerk_backend_api/models/web3wallet.py index 4df0fc3d..28972a08 100644 --- a/src/clerk_backend_api/models/web3wallet.py +++ b/src/clerk_backend_api/models/web3wallet.py @@ -76,7 +76,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member @@ -151,7 +151,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member @@ -232,7 +232,7 @@ def serialize_model(self, handler): for n, f in type(self).model_fields.items(): k = f.alias or n - val = serialized.get(k) + val = serialized.get(k, serialized.get(n)) is_nullable_and_explicitly_set = ( k in nullable_fields and (self.__pydantic_fields_set__.intersection({n})) # pylint: disable=no-member diff --git a/src/clerk_backend_api/organizationinvitations_sdk.py b/src/clerk_backend_api/organizationinvitations_sdk.py index a01db51e..13ed5cc0 100644 --- a/src/clerk_backend_api/organizationinvitations_sdk.py +++ b/src/clerk_backend_api/organizationinvitations_sdk.py @@ -377,7 +377,7 @@ def create( security_source=self.sdk_configuration.security, ), request=req, - error_status_codes=["400", "403", "404", "422", "4XX", "5XX"], + error_status_codes=["400", "402", "403", "404", "422", "4XX", "5XX"], retry_config=retry_config, ) @@ -385,7 +385,7 @@ def create( if utils.match_response(http_res, "200", "application/json"): return unmarshal_json_response(models.OrganizationInvitation, http_res) if utils.match_response( - http_res, ["400", "403", "404", "422"], "application/json" + http_res, ["400", "402", "403", "404", "422"], "application/json" ): response_data = unmarshal_json_response(models.ClerkErrorsData, http_res) raise models.ClerkErrors(response_data, http_res) @@ -521,7 +521,7 @@ async def create_async( security_source=self.sdk_configuration.security, ), request=req, - error_status_codes=["400", "403", "404", "422", "4XX", "5XX"], + error_status_codes=["400", "402", "403", "404", "422", "4XX", "5XX"], retry_config=retry_config, ) @@ -529,7 +529,7 @@ async def create_async( if utils.match_response(http_res, "200", "application/json"): return unmarshal_json_response(models.OrganizationInvitation, http_res) if utils.match_response( - http_res, ["400", "403", "404", "422"], "application/json" + http_res, ["400", "402", "403", "404", "422"], "application/json" ): response_data = unmarshal_json_response(models.ClerkErrorsData, http_res) raise models.ClerkErrors(response_data, http_res) diff --git a/src/clerk_backend_api/organizations_sdk.py b/src/clerk_backend_api/organizations_sdk.py index c83bda8b..768744ea 100644 --- a/src/clerk_backend_api/organizations_sdk.py +++ b/src/clerk_backend_api/organizations_sdk.py @@ -793,7 +793,7 @@ def update( security_source=self.sdk_configuration.security, ), request=req, - error_status_codes=["402", "403", "404", "422", "4XX", "5XX"], + error_status_codes=["400", "402", "403", "404", "422", "4XX", "5XX"], retry_config=retry_config, ) @@ -801,7 +801,7 @@ def update( if utils.match_response(http_res, "200", "application/json"): return unmarshal_json_response(models.Organization, http_res) if utils.match_response( - http_res, ["402", "403", "404", "422"], "application/json" + http_res, ["400", "402", "403", "404", "422"], "application/json" ): response_data = unmarshal_json_response(models.ClerkErrorsData, http_res) raise models.ClerkErrors(response_data, http_res) @@ -920,7 +920,7 @@ async def update_async( security_source=self.sdk_configuration.security, ), request=req, - error_status_codes=["402", "403", "404", "422", "4XX", "5XX"], + error_status_codes=["400", "402", "403", "404", "422", "4XX", "5XX"], retry_config=retry_config, ) @@ -928,7 +928,7 @@ async def update_async( if utils.match_response(http_res, "200", "application/json"): return unmarshal_json_response(models.Organization, http_res) if utils.match_response( - http_res, ["402", "403", "404", "422"], "application/json" + http_res, ["400", "402", "403", "404", "422"], "application/json" ): response_data = unmarshal_json_response(models.ClerkErrorsData, http_res) raise models.ClerkErrors(response_data, http_res) @@ -1954,3 +1954,465 @@ async def get_billing_subscription_async( raise models.SDKError("API error occurred", http_res, http_res_text) raise models.SDKError("Unexpected response received", http_res) + + def get_billing_credit_balance( + self, + *, + organization_id: str, + retries: OptionalNullable[utils.RetryConfig] = UNSET, + server_url: Optional[str] = None, + timeout_ms: Optional[int] = None, + http_headers: Optional[Mapping[str, str]] = None, + ) -> models.CommerceCreditBalanceResponse: + r"""Retrieve an organization's credit balance + + Retrieves the current credit balance for the specified organization. + Credits can be applied during checkout to reduce the charge or automatically applied to upcoming recurring charges. + + :param organization_id: The ID of the organization whose credit balance to retrieve + :param retries: Override the default retry configuration for this method + :param server_url: Override the default server URL for this method + :param timeout_ms: Override the default request timeout configuration for this method in milliseconds + :param http_headers: Additional headers to set or replace on requests. + """ + base_url = None + url_variables = None + if timeout_ms is None: + timeout_ms = self.sdk_configuration.timeout_ms + + if server_url is not None: + base_url = server_url + else: + base_url = self._get_url(base_url, url_variables) + + request = models.GetOrganizationBillingCreditBalanceRequest( + organization_id=organization_id, + ) + + req = self._build_request( + method="GET", + path="/organizations/{organization_id}/billing/credits", + base_url=base_url, + url_variables=url_variables, + request=request, + request_body_required=False, + request_has_path_params=True, + request_has_query_params=True, + user_agent_header="user-agent", + accept_header_value="application/json", + http_headers=http_headers, + security=self.sdk_configuration.security, + allow_empty_value=None, + timeout_ms=timeout_ms, + ) + + if retries == UNSET: + if self.sdk_configuration.retry_config is not UNSET: + retries = self.sdk_configuration.retry_config + else: + retries = utils.RetryConfig( + "backoff", utils.BackoffStrategy(500, 60000, 1.5, 3600000), True + ) + + retry_config = None + if isinstance(retries, utils.RetryConfig): + retry_config = (retries, ["5XX"]) + + http_res = self.do_request( + hook_ctx=HookContext( + config=self.sdk_configuration, + base_url=base_url or "", + operation_id="GetOrganizationBillingCreditBalance", + oauth2_scopes=None, + security_source=self.sdk_configuration.security, + ), + request=req, + error_status_codes=["400", "401", "403", "404", "422", "4XX", "500", "5XX"], + retry_config=retry_config, + ) + + response_data: Any = None + if utils.match_response(http_res, "200", "application/json"): + return unmarshal_json_response( + models.CommerceCreditBalanceResponse, http_res + ) + if utils.match_response( + http_res, ["400", "401", "403", "404", "422"], "application/json" + ): + response_data = unmarshal_json_response(models.ClerkErrorsData, http_res) + raise models.ClerkErrors(response_data, http_res) + if utils.match_response(http_res, "500", "application/json"): + response_data = unmarshal_json_response(models.ClerkErrorsData, http_res) + raise models.ClerkErrors(response_data, http_res) + if utils.match_response(http_res, "4XX", "*"): + http_res_text = utils.stream_to_text(http_res) + raise models.SDKError("API error occurred", http_res, http_res_text) + if utils.match_response(http_res, "5XX", "*"): + http_res_text = utils.stream_to_text(http_res) + raise models.SDKError("API error occurred", http_res, http_res_text) + + raise models.SDKError("Unexpected response received", http_res) + + async def get_billing_credit_balance_async( + self, + *, + organization_id: str, + retries: OptionalNullable[utils.RetryConfig] = UNSET, + server_url: Optional[str] = None, + timeout_ms: Optional[int] = None, + http_headers: Optional[Mapping[str, str]] = None, + ) -> models.CommerceCreditBalanceResponse: + r"""Retrieve an organization's credit balance + + Retrieves the current credit balance for the specified organization. + Credits can be applied during checkout to reduce the charge or automatically applied to upcoming recurring charges. + + :param organization_id: The ID of the organization whose credit balance to retrieve + :param retries: Override the default retry configuration for this method + :param server_url: Override the default server URL for this method + :param timeout_ms: Override the default request timeout configuration for this method in milliseconds + :param http_headers: Additional headers to set or replace on requests. + """ + base_url = None + url_variables = None + if timeout_ms is None: + timeout_ms = self.sdk_configuration.timeout_ms + + if server_url is not None: + base_url = server_url + else: + base_url = self._get_url(base_url, url_variables) + + request = models.GetOrganizationBillingCreditBalanceRequest( + organization_id=organization_id, + ) + + req = self._build_request_async( + method="GET", + path="/organizations/{organization_id}/billing/credits", + base_url=base_url, + url_variables=url_variables, + request=request, + request_body_required=False, + request_has_path_params=True, + request_has_query_params=True, + user_agent_header="user-agent", + accept_header_value="application/json", + http_headers=http_headers, + security=self.sdk_configuration.security, + allow_empty_value=None, + timeout_ms=timeout_ms, + ) + + if retries == UNSET: + if self.sdk_configuration.retry_config is not UNSET: + retries = self.sdk_configuration.retry_config + else: + retries = utils.RetryConfig( + "backoff", utils.BackoffStrategy(500, 60000, 1.5, 3600000), True + ) + + retry_config = None + if isinstance(retries, utils.RetryConfig): + retry_config = (retries, ["5XX"]) + + http_res = await self.do_request_async( + hook_ctx=HookContext( + config=self.sdk_configuration, + base_url=base_url or "", + operation_id="GetOrganizationBillingCreditBalance", + oauth2_scopes=None, + security_source=self.sdk_configuration.security, + ), + request=req, + error_status_codes=["400", "401", "403", "404", "422", "4XX", "500", "5XX"], + retry_config=retry_config, + ) + + response_data: Any = None + if utils.match_response(http_res, "200", "application/json"): + return unmarshal_json_response( + models.CommerceCreditBalanceResponse, http_res + ) + if utils.match_response( + http_res, ["400", "401", "403", "404", "422"], "application/json" + ): + response_data = unmarshal_json_response(models.ClerkErrorsData, http_res) + raise models.ClerkErrors(response_data, http_res) + if utils.match_response(http_res, "500", "application/json"): + response_data = unmarshal_json_response(models.ClerkErrorsData, http_res) + raise models.ClerkErrors(response_data, http_res) + if utils.match_response(http_res, "4XX", "*"): + http_res_text = await utils.stream_to_text_async(http_res) + raise models.SDKError("API error occurred", http_res, http_res_text) + if utils.match_response(http_res, "5XX", "*"): + http_res_text = await utils.stream_to_text_async(http_res) + raise models.SDKError("API error occurred", http_res, http_res_text) + + raise models.SDKError("Unexpected response received", http_res) + + def adjust_billing_credit_balance( + self, + *, + organization_id: str, + amount: int, + action: models.Action, + idempotency_key: str, + currency: Optional[str] = None, + note: Optional[str] = None, + retries: OptionalNullable[utils.RetryConfig] = UNSET, + server_url: Optional[str] = None, + timeout_ms: Optional[int] = None, + http_headers: Optional[Mapping[str, str]] = None, + ) -> models.CommerceCreditLedgerResponse: + r"""Adjust an organization's credit balance + + Increases or decreases the credit balance for the specified organization. + Each adjustment is recorded as a ledger entry. The idempotency_key parameter + ensures that duplicate requests are safely handled. + + :param organization_id: The ID of the organization whose credit balance to adjust + :param amount: The credit amount in cents. Must be greater than zero. + :param action: Whether to increase or decrease the credit balance. + :param idempotency_key: A unique key to ensure the adjustment is applied only once. Repeated requests with the same key return the original ledger entry. + :param currency: The currency code (e.g. \"USD\"). Defaults to USD if not provided. + :param note: An optional note to attach to the ledger entry. + :param retries: Override the default retry configuration for this method + :param server_url: Override the default server URL for this method + :param timeout_ms: Override the default request timeout configuration for this method in milliseconds + :param http_headers: Additional headers to set or replace on requests. + """ + base_url = None + url_variables = None + if timeout_ms is None: + timeout_ms = self.sdk_configuration.timeout_ms + + if server_url is not None: + base_url = server_url + else: + base_url = self._get_url(base_url, url_variables) + + request = models.AdjustOrganizationBillingCreditBalanceRequest( + organization_id=organization_id, + adjust_credit_balance_request=models.AdjustCreditBalanceRequest( + amount=amount, + action=action, + currency=currency, + idempotency_key=idempotency_key, + note=note, + ), + ) + + req = self._build_request( + method="POST", + path="/organizations/{organization_id}/billing/credits", + base_url=base_url, + url_variables=url_variables, + request=request, + request_body_required=True, + request_has_path_params=True, + request_has_query_params=True, + user_agent_header="user-agent", + accept_header_value="application/json", + http_headers=http_headers, + security=self.sdk_configuration.security, + get_serialized_body=lambda: utils.serialize_request_body( + request.adjust_credit_balance_request, + False, + False, + "json", + models.AdjustCreditBalanceRequest, + ), + allow_empty_value=None, + timeout_ms=timeout_ms, + ) + + if retries == UNSET: + if self.sdk_configuration.retry_config is not UNSET: + retries = self.sdk_configuration.retry_config + else: + retries = utils.RetryConfig( + "backoff", utils.BackoffStrategy(500, 60000, 1.5, 3600000), True + ) + + retry_config = None + if isinstance(retries, utils.RetryConfig): + retry_config = (retries, ["5XX"]) + + http_res = self.do_request( + hook_ctx=HookContext( + config=self.sdk_configuration, + base_url=base_url or "", + operation_id="AdjustOrganizationBillingCreditBalance", + oauth2_scopes=None, + security_source=self.sdk_configuration.security, + ), + request=req, + error_status_codes=[ + "400", + "401", + "403", + "404", + "409", + "422", + "4XX", + "500", + "5XX", + ], + retry_config=retry_config, + ) + + response_data: Any = None + if utils.match_response(http_res, "200", "application/json"): + return unmarshal_json_response( + models.CommerceCreditLedgerResponse, http_res + ) + if utils.match_response( + http_res, ["400", "401", "403", "404", "409", "422"], "application/json" + ): + response_data = unmarshal_json_response(models.ClerkErrorsData, http_res) + raise models.ClerkErrors(response_data, http_res) + if utils.match_response(http_res, "500", "application/json"): + response_data = unmarshal_json_response(models.ClerkErrorsData, http_res) + raise models.ClerkErrors(response_data, http_res) + if utils.match_response(http_res, "4XX", "*"): + http_res_text = utils.stream_to_text(http_res) + raise models.SDKError("API error occurred", http_res, http_res_text) + if utils.match_response(http_res, "5XX", "*"): + http_res_text = utils.stream_to_text(http_res) + raise models.SDKError("API error occurred", http_res, http_res_text) + + raise models.SDKError("Unexpected response received", http_res) + + async def adjust_billing_credit_balance_async( + self, + *, + organization_id: str, + amount: int, + action: models.Action, + idempotency_key: str, + currency: Optional[str] = None, + note: Optional[str] = None, + retries: OptionalNullable[utils.RetryConfig] = UNSET, + server_url: Optional[str] = None, + timeout_ms: Optional[int] = None, + http_headers: Optional[Mapping[str, str]] = None, + ) -> models.CommerceCreditLedgerResponse: + r"""Adjust an organization's credit balance + + Increases or decreases the credit balance for the specified organization. + Each adjustment is recorded as a ledger entry. The idempotency_key parameter + ensures that duplicate requests are safely handled. + + :param organization_id: The ID of the organization whose credit balance to adjust + :param amount: The credit amount in cents. Must be greater than zero. + :param action: Whether to increase or decrease the credit balance. + :param idempotency_key: A unique key to ensure the adjustment is applied only once. Repeated requests with the same key return the original ledger entry. + :param currency: The currency code (e.g. \"USD\"). Defaults to USD if not provided. + :param note: An optional note to attach to the ledger entry. + :param retries: Override the default retry configuration for this method + :param server_url: Override the default server URL for this method + :param timeout_ms: Override the default request timeout configuration for this method in milliseconds + :param http_headers: Additional headers to set or replace on requests. + """ + base_url = None + url_variables = None + if timeout_ms is None: + timeout_ms = self.sdk_configuration.timeout_ms + + if server_url is not None: + base_url = server_url + else: + base_url = self._get_url(base_url, url_variables) + + request = models.AdjustOrganizationBillingCreditBalanceRequest( + organization_id=organization_id, + adjust_credit_balance_request=models.AdjustCreditBalanceRequest( + amount=amount, + action=action, + currency=currency, + idempotency_key=idempotency_key, + note=note, + ), + ) + + req = self._build_request_async( + method="POST", + path="/organizations/{organization_id}/billing/credits", + base_url=base_url, + url_variables=url_variables, + request=request, + request_body_required=True, + request_has_path_params=True, + request_has_query_params=True, + user_agent_header="user-agent", + accept_header_value="application/json", + http_headers=http_headers, + security=self.sdk_configuration.security, + get_serialized_body=lambda: utils.serialize_request_body( + request.adjust_credit_balance_request, + False, + False, + "json", + models.AdjustCreditBalanceRequest, + ), + allow_empty_value=None, + timeout_ms=timeout_ms, + ) + + if retries == UNSET: + if self.sdk_configuration.retry_config is not UNSET: + retries = self.sdk_configuration.retry_config + else: + retries = utils.RetryConfig( + "backoff", utils.BackoffStrategy(500, 60000, 1.5, 3600000), True + ) + + retry_config = None + if isinstance(retries, utils.RetryConfig): + retry_config = (retries, ["5XX"]) + + http_res = await self.do_request_async( + hook_ctx=HookContext( + config=self.sdk_configuration, + base_url=base_url or "", + operation_id="AdjustOrganizationBillingCreditBalance", + oauth2_scopes=None, + security_source=self.sdk_configuration.security, + ), + request=req, + error_status_codes=[ + "400", + "401", + "403", + "404", + "409", + "422", + "4XX", + "500", + "5XX", + ], + retry_config=retry_config, + ) + + response_data: Any = None + if utils.match_response(http_res, "200", "application/json"): + return unmarshal_json_response( + models.CommerceCreditLedgerResponse, http_res + ) + if utils.match_response( + http_res, ["400", "401", "403", "404", "409", "422"], "application/json" + ): + response_data = unmarshal_json_response(models.ClerkErrorsData, http_res) + raise models.ClerkErrors(response_data, http_res) + if utils.match_response(http_res, "500", "application/json"): + response_data = unmarshal_json_response(models.ClerkErrorsData, http_res) + raise models.ClerkErrors(response_data, http_res) + if utils.match_response(http_res, "4XX", "*"): + http_res_text = await utils.stream_to_text_async(http_res) + raise models.SDKError("API error occurred", http_res, http_res_text) + if utils.match_response(http_res, "5XX", "*"): + http_res_text = await utils.stream_to_text_async(http_res) + raise models.SDKError("API error occurred", http_res, http_res_text) + + raise models.SDKError("Unexpected response received", http_res) diff --git a/src/clerk_backend_api/sdk.py b/src/clerk_backend_api/sdk.py index 61a9f03a..609eb77d 100644 --- a/src/clerk_backend_api/sdk.py +++ b/src/clerk_backend_api/sdk.py @@ -26,6 +26,7 @@ if TYPE_CHECKING: from clerk_backend_api.actortokens import ActorTokens + from clerk_backend_api.agenttasks import AgentTasks from clerk_backend_api.allowlistidentifiers import AllowlistIdentifiers from clerk_backend_api.api_keys import APIKeys from clerk_backend_api.betafeatures import BetaFeatures @@ -111,6 +112,7 @@ class Clerk(BaseSDK): oauth_applications: "OauthApplicationsSDK" saml_connections: "SamlConnectionsSDK" testing_tokens: "TestingTokens" + agent_tasks: "AgentTasks" waitlist_entries: "WaitlistEntriesSDK" billing: "Billing" organization_permissions: "OrganizationPermissions" @@ -185,6 +187,7 @@ class Clerk(BaseSDK): "SamlConnectionsSDK", ), "testing_tokens": ("clerk_backend_api.testingtokens", "TestingTokens"), + "agent_tasks": ("clerk_backend_api.agenttasks", "AgentTasks"), "waitlist_entries": ( "clerk_backend_api.waitlistentries_sdk", "WaitlistEntriesSDK", @@ -207,8 +210,8 @@ def __init__( self, bearer_auth: Optional[Union[Optional[str], Callable[[], Optional[str]]]] = None, server_idx: Optional[int] = None, - server_url: Optional[str] = None, url_params: Optional[Dict[str, str]] = None, + server_url: Optional[str] = None, client: Optional[HttpClient] = None, async_client: Optional[AsyncHttpClient] = None, retry_config: OptionalNullable[RetryConfig] = UNSET, diff --git a/src/clerk_backend_api/sessions.py b/src/clerk_backend_api/sessions.py index e814b636..4e044256 100644 --- a/src/clerk_backend_api/sessions.py +++ b/src/clerk_backend_api/sessions.py @@ -25,8 +25,11 @@ def list( ) -> List[models.Session]: r"""List all sessions - Returns a list of all sessions. + Returns a list of sessions matching the provided criteria. The sessions are returned sorted by creation date, with the newest sessions appearing first. + + Note: This endpoint does not return all sessions that have ever existed. Old and inactive sessions are periodically cleaned up and will not be included in the results. + **Deprecation Notice (2024-01-01):** All parameters were initially considered optional, however moving forward at least one of `client_id` or `user_id` parameters should be provided. @@ -138,8 +141,11 @@ async def list_async( ) -> List[models.Session]: r"""List all sessions - Returns a list of all sessions. + Returns a list of sessions matching the provided criteria. The sessions are returned sorted by creation date, with the newest sessions appearing first. + + Note: This endpoint does not return all sessions that have ever existed. Old and inactive sessions are periodically cleaned up and will not be included in the results. + **Deprecation Notice (2024-01-01):** All parameters were initially considered optional, however moving forward at least one of `client_id` or `user_id` parameters should be provided. diff --git a/src/clerk_backend_api/users.py b/src/clerk_backend_api/users.py index a08e4c5f..08053d45 100644 --- a/src/clerk_backend_api/users.py +++ b/src/clerk_backend_api/users.py @@ -1172,7 +1172,7 @@ def update( security_source=self.sdk_configuration.security, ), request=req, - error_status_codes=["400", "401", "404", "422", "4XX", "5XX"], + error_status_codes=["400", "401", "404", "409", "422", "4XX", "5XX"], retry_config=retry_config, ) @@ -1180,7 +1180,7 @@ def update( if utils.match_response(http_res, "200", "application/json"): return unmarshal_json_response(models.User, http_res) if utils.match_response( - http_res, ["400", "401", "404", "422"], "application/json" + http_res, ["400", "401", "404", "409", "422"], "application/json" ): response_data = unmarshal_json_response(models.ClerkErrorsData, http_res) raise models.ClerkErrors(response_data, http_res) @@ -1384,7 +1384,7 @@ async def update_async( security_source=self.sdk_configuration.security, ), request=req, - error_status_codes=["400", "401", "404", "422", "4XX", "5XX"], + error_status_codes=["400", "401", "404", "409", "422", "4XX", "5XX"], retry_config=retry_config, ) @@ -1392,7 +1392,7 @@ async def update_async( if utils.match_response(http_res, "200", "application/json"): return unmarshal_json_response(models.User, http_res) if utils.match_response( - http_res, ["400", "401", "404", "422"], "application/json" + http_res, ["400", "401", "404", "409", "422"], "application/json" ): response_data = unmarshal_json_response(models.ClerkErrorsData, http_res) raise models.ClerkErrors(response_data, http_res) @@ -3501,6 +3501,468 @@ async def get_billing_subscription_async( raise models.SDKError("Unexpected response received", http_res) + def get_billing_credit_balance( + self, + *, + user_id: str, + retries: OptionalNullable[utils.RetryConfig] = UNSET, + server_url: Optional[str] = None, + timeout_ms: Optional[int] = None, + http_headers: Optional[Mapping[str, str]] = None, + ) -> models.CommerceCreditBalanceResponse: + r"""Retrieve a user's credit balance + + Retrieves the current credit balance for the specified user. + Credits can be applied during checkout to reduce the charge or automatically applied to upcoming recurring charges + + :param user_id: The ID of the user whose credit balance to retrieve + :param retries: Override the default retry configuration for this method + :param server_url: Override the default server URL for this method + :param timeout_ms: Override the default request timeout configuration for this method in milliseconds + :param http_headers: Additional headers to set or replace on requests. + """ + base_url = None + url_variables = None + if timeout_ms is None: + timeout_ms = self.sdk_configuration.timeout_ms + + if server_url is not None: + base_url = server_url + else: + base_url = self._get_url(base_url, url_variables) + + request = models.GetUserBillingCreditBalanceRequest( + user_id=user_id, + ) + + req = self._build_request( + method="GET", + path="/users/{user_id}/billing/credits", + base_url=base_url, + url_variables=url_variables, + request=request, + request_body_required=False, + request_has_path_params=True, + request_has_query_params=True, + user_agent_header="user-agent", + accept_header_value="application/json", + http_headers=http_headers, + security=self.sdk_configuration.security, + allow_empty_value=None, + timeout_ms=timeout_ms, + ) + + if retries == UNSET: + if self.sdk_configuration.retry_config is not UNSET: + retries = self.sdk_configuration.retry_config + else: + retries = utils.RetryConfig( + "backoff", utils.BackoffStrategy(500, 60000, 1.5, 3600000), True + ) + + retry_config = None + if isinstance(retries, utils.RetryConfig): + retry_config = (retries, ["5XX"]) + + http_res = self.do_request( + hook_ctx=HookContext( + config=self.sdk_configuration, + base_url=base_url or "", + operation_id="GetUserBillingCreditBalance", + oauth2_scopes=None, + security_source=self.sdk_configuration.security, + ), + request=req, + error_status_codes=["400", "401", "403", "404", "422", "4XX", "500", "5XX"], + retry_config=retry_config, + ) + + response_data: Any = None + if utils.match_response(http_res, "200", "application/json"): + return unmarshal_json_response( + models.CommerceCreditBalanceResponse, http_res + ) + if utils.match_response( + http_res, ["400", "401", "403", "404", "422"], "application/json" + ): + response_data = unmarshal_json_response(models.ClerkErrorsData, http_res) + raise models.ClerkErrors(response_data, http_res) + if utils.match_response(http_res, "500", "application/json"): + response_data = unmarshal_json_response(models.ClerkErrorsData, http_res) + raise models.ClerkErrors(response_data, http_res) + if utils.match_response(http_res, "4XX", "*"): + http_res_text = utils.stream_to_text(http_res) + raise models.SDKError("API error occurred", http_res, http_res_text) + if utils.match_response(http_res, "5XX", "*"): + http_res_text = utils.stream_to_text(http_res) + raise models.SDKError("API error occurred", http_res, http_res_text) + + raise models.SDKError("Unexpected response received", http_res) + + async def get_billing_credit_balance_async( + self, + *, + user_id: str, + retries: OptionalNullable[utils.RetryConfig] = UNSET, + server_url: Optional[str] = None, + timeout_ms: Optional[int] = None, + http_headers: Optional[Mapping[str, str]] = None, + ) -> models.CommerceCreditBalanceResponse: + r"""Retrieve a user's credit balance + + Retrieves the current credit balance for the specified user. + Credits can be applied during checkout to reduce the charge or automatically applied to upcoming recurring charges + + :param user_id: The ID of the user whose credit balance to retrieve + :param retries: Override the default retry configuration for this method + :param server_url: Override the default server URL for this method + :param timeout_ms: Override the default request timeout configuration for this method in milliseconds + :param http_headers: Additional headers to set or replace on requests. + """ + base_url = None + url_variables = None + if timeout_ms is None: + timeout_ms = self.sdk_configuration.timeout_ms + + if server_url is not None: + base_url = server_url + else: + base_url = self._get_url(base_url, url_variables) + + request = models.GetUserBillingCreditBalanceRequest( + user_id=user_id, + ) + + req = self._build_request_async( + method="GET", + path="/users/{user_id}/billing/credits", + base_url=base_url, + url_variables=url_variables, + request=request, + request_body_required=False, + request_has_path_params=True, + request_has_query_params=True, + user_agent_header="user-agent", + accept_header_value="application/json", + http_headers=http_headers, + security=self.sdk_configuration.security, + allow_empty_value=None, + timeout_ms=timeout_ms, + ) + + if retries == UNSET: + if self.sdk_configuration.retry_config is not UNSET: + retries = self.sdk_configuration.retry_config + else: + retries = utils.RetryConfig( + "backoff", utils.BackoffStrategy(500, 60000, 1.5, 3600000), True + ) + + retry_config = None + if isinstance(retries, utils.RetryConfig): + retry_config = (retries, ["5XX"]) + + http_res = await self.do_request_async( + hook_ctx=HookContext( + config=self.sdk_configuration, + base_url=base_url or "", + operation_id="GetUserBillingCreditBalance", + oauth2_scopes=None, + security_source=self.sdk_configuration.security, + ), + request=req, + error_status_codes=["400", "401", "403", "404", "422", "4XX", "500", "5XX"], + retry_config=retry_config, + ) + + response_data: Any = None + if utils.match_response(http_res, "200", "application/json"): + return unmarshal_json_response( + models.CommerceCreditBalanceResponse, http_res + ) + if utils.match_response( + http_res, ["400", "401", "403", "404", "422"], "application/json" + ): + response_data = unmarshal_json_response(models.ClerkErrorsData, http_res) + raise models.ClerkErrors(response_data, http_res) + if utils.match_response(http_res, "500", "application/json"): + response_data = unmarshal_json_response(models.ClerkErrorsData, http_res) + raise models.ClerkErrors(response_data, http_res) + if utils.match_response(http_res, "4XX", "*"): + http_res_text = await utils.stream_to_text_async(http_res) + raise models.SDKError("API error occurred", http_res, http_res_text) + if utils.match_response(http_res, "5XX", "*"): + http_res_text = await utils.stream_to_text_async(http_res) + raise models.SDKError("API error occurred", http_res, http_res_text) + + raise models.SDKError("Unexpected response received", http_res) + + def adjust_billing_credit_balance( + self, + *, + user_id: str, + amount: int, + action: models.Action, + idempotency_key: str, + currency: Optional[str] = None, + note: Optional[str] = None, + retries: OptionalNullable[utils.RetryConfig] = UNSET, + server_url: Optional[str] = None, + timeout_ms: Optional[int] = None, + http_headers: Optional[Mapping[str, str]] = None, + ) -> models.CommerceCreditLedgerResponse: + r"""Adjust a user's credit balance + + Increases or decreases the credit balance for the specified user. + Each adjustment is recorded as a ledger entry. The idempotency_key parameter + ensures that duplicate requests are safely handled. + + :param user_id: The ID of the user whose credit balance to adjust + :param amount: The credit amount in cents. Must be greater than zero. + :param action: Whether to increase or decrease the credit balance. + :param idempotency_key: A unique key to ensure the adjustment is applied only once. Repeated requests with the same key return the original ledger entry. + :param currency: The currency code (e.g. \"USD\"). Defaults to USD if not provided. + :param note: An optional note to attach to the ledger entry. + :param retries: Override the default retry configuration for this method + :param server_url: Override the default server URL for this method + :param timeout_ms: Override the default request timeout configuration for this method in milliseconds + :param http_headers: Additional headers to set or replace on requests. + """ + base_url = None + url_variables = None + if timeout_ms is None: + timeout_ms = self.sdk_configuration.timeout_ms + + if server_url is not None: + base_url = server_url + else: + base_url = self._get_url(base_url, url_variables) + + request = models.AdjustUserBillingCreditBalanceRequest( + user_id=user_id, + adjust_credit_balance_request=models.AdjustCreditBalanceRequest( + amount=amount, + action=action, + currency=currency, + idempotency_key=idempotency_key, + note=note, + ), + ) + + req = self._build_request( + method="POST", + path="/users/{user_id}/billing/credits", + base_url=base_url, + url_variables=url_variables, + request=request, + request_body_required=True, + request_has_path_params=True, + request_has_query_params=True, + user_agent_header="user-agent", + accept_header_value="application/json", + http_headers=http_headers, + security=self.sdk_configuration.security, + get_serialized_body=lambda: utils.serialize_request_body( + request.adjust_credit_balance_request, + False, + False, + "json", + models.AdjustCreditBalanceRequest, + ), + allow_empty_value=None, + timeout_ms=timeout_ms, + ) + + if retries == UNSET: + if self.sdk_configuration.retry_config is not UNSET: + retries = self.sdk_configuration.retry_config + else: + retries = utils.RetryConfig( + "backoff", utils.BackoffStrategy(500, 60000, 1.5, 3600000), True + ) + + retry_config = None + if isinstance(retries, utils.RetryConfig): + retry_config = (retries, ["5XX"]) + + http_res = self.do_request( + hook_ctx=HookContext( + config=self.sdk_configuration, + base_url=base_url or "", + operation_id="AdjustUserBillingCreditBalance", + oauth2_scopes=None, + security_source=self.sdk_configuration.security, + ), + request=req, + error_status_codes=[ + "400", + "401", + "403", + "404", + "409", + "422", + "4XX", + "500", + "5XX", + ], + retry_config=retry_config, + ) + + response_data: Any = None + if utils.match_response(http_res, "200", "application/json"): + return unmarshal_json_response( + models.CommerceCreditLedgerResponse, http_res + ) + if utils.match_response( + http_res, ["400", "401", "403", "404", "409", "422"], "application/json" + ): + response_data = unmarshal_json_response(models.ClerkErrorsData, http_res) + raise models.ClerkErrors(response_data, http_res) + if utils.match_response(http_res, "500", "application/json"): + response_data = unmarshal_json_response(models.ClerkErrorsData, http_res) + raise models.ClerkErrors(response_data, http_res) + if utils.match_response(http_res, "4XX", "*"): + http_res_text = utils.stream_to_text(http_res) + raise models.SDKError("API error occurred", http_res, http_res_text) + if utils.match_response(http_res, "5XX", "*"): + http_res_text = utils.stream_to_text(http_res) + raise models.SDKError("API error occurred", http_res, http_res_text) + + raise models.SDKError("Unexpected response received", http_res) + + async def adjust_billing_credit_balance_async( + self, + *, + user_id: str, + amount: int, + action: models.Action, + idempotency_key: str, + currency: Optional[str] = None, + note: Optional[str] = None, + retries: OptionalNullable[utils.RetryConfig] = UNSET, + server_url: Optional[str] = None, + timeout_ms: Optional[int] = None, + http_headers: Optional[Mapping[str, str]] = None, + ) -> models.CommerceCreditLedgerResponse: + r"""Adjust a user's credit balance + + Increases or decreases the credit balance for the specified user. + Each adjustment is recorded as a ledger entry. The idempotency_key parameter + ensures that duplicate requests are safely handled. + + :param user_id: The ID of the user whose credit balance to adjust + :param amount: The credit amount in cents. Must be greater than zero. + :param action: Whether to increase or decrease the credit balance. + :param idempotency_key: A unique key to ensure the adjustment is applied only once. Repeated requests with the same key return the original ledger entry. + :param currency: The currency code (e.g. \"USD\"). Defaults to USD if not provided. + :param note: An optional note to attach to the ledger entry. + :param retries: Override the default retry configuration for this method + :param server_url: Override the default server URL for this method + :param timeout_ms: Override the default request timeout configuration for this method in milliseconds + :param http_headers: Additional headers to set or replace on requests. + """ + base_url = None + url_variables = None + if timeout_ms is None: + timeout_ms = self.sdk_configuration.timeout_ms + + if server_url is not None: + base_url = server_url + else: + base_url = self._get_url(base_url, url_variables) + + request = models.AdjustUserBillingCreditBalanceRequest( + user_id=user_id, + adjust_credit_balance_request=models.AdjustCreditBalanceRequest( + amount=amount, + action=action, + currency=currency, + idempotency_key=idempotency_key, + note=note, + ), + ) + + req = self._build_request_async( + method="POST", + path="/users/{user_id}/billing/credits", + base_url=base_url, + url_variables=url_variables, + request=request, + request_body_required=True, + request_has_path_params=True, + request_has_query_params=True, + user_agent_header="user-agent", + accept_header_value="application/json", + http_headers=http_headers, + security=self.sdk_configuration.security, + get_serialized_body=lambda: utils.serialize_request_body( + request.adjust_credit_balance_request, + False, + False, + "json", + models.AdjustCreditBalanceRequest, + ), + allow_empty_value=None, + timeout_ms=timeout_ms, + ) + + if retries == UNSET: + if self.sdk_configuration.retry_config is not UNSET: + retries = self.sdk_configuration.retry_config + else: + retries = utils.RetryConfig( + "backoff", utils.BackoffStrategy(500, 60000, 1.5, 3600000), True + ) + + retry_config = None + if isinstance(retries, utils.RetryConfig): + retry_config = (retries, ["5XX"]) + + http_res = await self.do_request_async( + hook_ctx=HookContext( + config=self.sdk_configuration, + base_url=base_url or "", + operation_id="AdjustUserBillingCreditBalance", + oauth2_scopes=None, + security_source=self.sdk_configuration.security, + ), + request=req, + error_status_codes=[ + "400", + "401", + "403", + "404", + "409", + "422", + "4XX", + "500", + "5XX", + ], + retry_config=retry_config, + ) + + response_data: Any = None + if utils.match_response(http_res, "200", "application/json"): + return unmarshal_json_response( + models.CommerceCreditLedgerResponse, http_res + ) + if utils.match_response( + http_res, ["400", "401", "403", "404", "409", "422"], "application/json" + ): + response_data = unmarshal_json_response(models.ClerkErrorsData, http_res) + raise models.ClerkErrors(response_data, http_res) + if utils.match_response(http_res, "500", "application/json"): + response_data = unmarshal_json_response(models.ClerkErrorsData, http_res) + raise models.ClerkErrors(response_data, http_res) + if utils.match_response(http_res, "4XX", "*"): + http_res_text = await utils.stream_to_text_async(http_res) + raise models.SDKError("API error occurred", http_res, http_res_text) + if utils.match_response(http_res, "5XX", "*"): + http_res_text = await utils.stream_to_text_async(http_res) + raise models.SDKError("API error occurred", http_res, http_res_text) + + raise models.SDKError("Unexpected response received", http_res) + def get_o_auth_access_token( self, *, From 4d799329d529397fd394eddeb72fe1796aaa1180 Mon Sep 17 00:00:00 2001 From: "speakeasy-github[bot]" <128539517+speakeasy-github[bot]@users.noreply.github.com> Date: Mon, 9 Mar 2026 00:32:56 +0000 Subject: [PATCH 2/2] empty commit to trigger [run-tests] workflow